DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31099 and CG31974

DIOPT Version :9

Sequence 1:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster


Alignment Length:379 Identity:85/379 - (22%)
Similarity:159/379 - (41%) Gaps:68/379 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KVPKIPDWVSSLSLNQAVHSVLEDGVQITSVIPSVHLIQFRNC-TVLLPIQVKVQLRDFTMKKLF 65
            :||||.      :|.|.:...|.:|..:.|...|.......|. :::|.:|.|::..|..::.|.
  Fly     3 EVPKIK------NLPQVIEPHLPEGCTLDSYSTSYLTKPGDNYGSIMLSVQAKIRSADGGIRDLP 61

  Fly    66 FLLKAQHGT-DIQAMVMNQLKMFQREHQVYHNVLPKLEEIY---------------REVGKKVSF 114
            .:.|....| |:...:....:....|:.||..:.|:|:::.               |..|.:||.
  Fly    62 LIAKLPPLTNDLYWQIFQPERTCITENAVYQYLSPELDKLQLESGILPAQIFDGFPRYYGSRVSL 126

  Fly   115 GPRAFRLDY-SIGVQYVLLEDLKAKSYKNVERQAGFNKLCLKQVLKKLAQFHAAS-AVCVEKHGA 177
            ..||.::|. ::.||    |::..:.|:...|...:|......:|..|||:||.. |:.::|...
  Fly   127 DNRATKVDRDAVLVQ----ENVTTRGYRPGNRHRPYNLAETVLILHYLAQYHALPIALRLKKPQV 187

  Fly   178 FSNLL--------VNGVYTKANESVLQE--LNDPEIFLSQLRRWRLGDHFHKRLVEKEKDLVD-- 230
            :...:        :|....:|...::.:  |.|.::..|.           :|.|.:.|:|:|  
  Fly   188 YEEYVRPYFKKFDMNSNIDQAETEIMNKEILKDIKLVTSD-----------ERDVNRVKELLDIF 241

  Fly   231 -GLLKLHSPDSNEFNVLNHSDCWVNNVMFKFDDSGHVEDTAL----LDYQLVKYGSPAIDLYYTI 290
             .....:..|...|..|.|.|.|:||:|.|:...|. |.|.|    :|:|:.:|||...|:.:.:
  Fly   242 QAFQASNDVDDGPFTTLVHGDLWINNMMLKYGMRGE-EGTPLKVKIVDFQIAQYGSLVHDIIFVL 305

  Fly   291 LSSAEKDIKLAQFDNMVQYYFYHLLDNLKALN----------FGGSLPQLQHIR 334
            .||.:.::....|.|.:..|:...:..|:::|          |...:.|..|::
  Fly   306 FSSVDVNVLEDNFYNFLTIYYNAFIQTLRSVNVDTSNYTYELFLEEVQQTAHVQ 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 71/324 (22%)
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 71/317 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459631
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.