DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31099 and CG7135

DIOPT Version :9

Sequence 1:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster


Alignment Length:418 Identity:104/418 - (24%)
Similarity:183/418 - (43%) Gaps:77/418 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GVQITSVIPSVHLIQFRNCTVLLPIQVKVQLRDFTMKKLFFLLKAQHGTDIQAMVMNQLKMFQRE 90
            |||:|::.....    ..|:.:...|:|.:..:....:...::|:.  .|.:..::.:|.::.:|
  Fly    34 GVQLTNLTRGGE----NYCSNIYRAQIKYRNAESCAMETSLIVKSM--PDEKQAILARLHIYNKE 92

  Fly    91 HQVYHNVLPKLEEI-YREVGKKVSF-----GPRAFRLDYSI--GVQYVLLEDLKAKSYKNVERQA 147
            ...|.::.||||.: :|.|.   ||     .|:.:   ||.  ..|.::||||.|..|:...||.
  Fly    93 TLFYMHIKPKLEALMWRAVD---SFSAWTLAPKHY---YSTTQPEQTIILEDLCAAGYQLKCRQL 151

  Fly   148 G--FNKLCLKQVLKKLAQFHAASAVCVEKHG-------AFSNLLVNGVYTKANESVLQELNDPEI 203
            |  |:...|  |:.|||::||.:.|..|:..       .|..|.::.:.::..:.         :
  Fly   152 GLDFDHAAL--VMAKLAEYHALTMVMAEREPETIVDRYPFGLLHMDAINSEPFKL---------L 205

  Fly   204 FLSQL------------------RRWRLGDHFHKRLVEKEKDLVDGLLKLHSPDSNEFNVLNHSD 250
            |.:||                  :.:|..:||.:|           :||...|.....|||||.|
  Fly   206 FGTQLLKLAALVGDCEGFGGITTKLYRYHEHFTER-----------VLKAVYPLRGNHNVLNHGD 259

  Fly   251 CWVNNVMFKFDDSGHVEDTALLDYQLVKYGSPAIDLYYTILSSAEKDIKLAQFDNMVQYYFYHLL 315
            .||||:.||:|....|:...::|:||..|||...|:.|.:.:|.|.::...:...:|..|:..|:
  Fly   260 LWVNNIFFKYDAEYTVQQVKIIDFQLCFYGSLGFDINYFLNTSLELEVLRDRRQELVDIYYRSLV 324

  Fly   316 DNLKALNFGGSLPQLQHIRDALNKNGLAAYVVVTRALPITMMNQFEDEVN-------ERYASKMK 373
            |.||.|.:...||..:.|.|.:.|.....:.|.....|:..|...:.|.|       |.:|.:..
  Fly   325 DCLKHLPWSKELPSYEDIMDEIRKREAYGFFVAFGFFPLMSMIGVDSEDNSLKNFHDETFARQKV 389

  Fly   374 CAMFT-SRKYIQAIKDILPWMEERSLLN 400
            ..||. :.:.::::|..|..::|..|.:
  Fly   390 QLMFEGNTRTLESLKCTLKRLDELKLFD 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 82/313 (26%)
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 81/320 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459252
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.