DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31099 and CG31975

DIOPT Version :9

Sequence 1:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster


Alignment Length:446 Identity:89/446 - (19%)
Similarity:163/446 - (36%) Gaps:142/446 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVPKIPDWVSSLS------------LNQAVHSVLEDGVQITSVIPSVHLIQFRNCTVLLPIQVK 53
            |.|.|:|: :.:||            ||....|:.:.|....||:.::|.               
  Fly     1 MGVDKLPE-IRALSEVVEPHVSGSRLLNYHTSSLTKPGDNYGSVLLAIHA--------------- 49

  Fly    54 VQLRDFTMKKLFFLLKAQHGTDIQAMVMNQL--------KMFQ------REHQVYHNVLPKLEEI 104
                         .|:..:|...:..::.::        :.||      .|:.||..:.|.|..:
  Fly    50 -------------RLQKSNGESFEEQLVAKVPPIDPKYWQFFQPEQTCLTENAVYKILAPALATL 101

  Fly   105 YREVGK---------------KVSFGPRAFRLDYSIGVQYVLLEDLKAKSYKNVERQAGFNKLCL 154
            ..|.|.               :.|....:.::|.:   ..::||:|::..|.:.:|...|:....
  Fly   102 QDEAGVPDESQFKGFPRFYGCRESLESNSSKVDQN---AVLVLENLRSSGYVSGQRLKAFDLAHT 163

  Fly   155 KQVLKKLAQFHAASAVCVEKHGAFSNLLVNGVYTKANESVLQELNDPEIFLSQLR---------- 209
            ...||.:|:|||.|.                        .|:.|. ||:|..|:|          
  Fly   164 LLALKYMAEFHALSL------------------------ALRILR-PEVFREQVRPFFKKFDWHA 203

  Fly   210 ---RW------------RLGDHFHKRLVEKEKDLVDGLLKL--HSPD--SNEFNVLNHSDCWVNN 255
               .|            |...:...|||.:.|:|.|...:.  .:||  ...|..:.|.|.|:||
  Fly   204 EAPEWKSVMKAETLEDIRRATNNDSRLVARMKELSDQFFEFLAAAPDRPDGPFTSIIHCDFWINN 268

  Fly   256 VMFKFDDSGHVEDTALLDYQLVKYGSPAIDLYYTILSSAEKDIKLAQFDNMVQYYFYHLLDNLKA 320
            :||::..:|...:..::|:|..:|.|...|:...:|||.:..|...:|::|::.| |...:  :.
  Fly   269 IMFRYGPTGTPVELKIIDFQTAQYDSVVHDIISFLLSSVDTAILEVEFEHMLEAY-YEAFE--RC 330

  Fly   321 LNFGGSLPQLQHIRDALNKNGLAAYVVVTRALPITMMNQF---------EDEVNER 367
            |...|:..::...::...:....||:.|..|:   .|.:|         :.|..||
  Fly   331 LRRVGAKLEVHTFKEFRLEVKRVAYIQVPHAI---FMTRFILADSALIGDSEAEER 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 66/336 (20%)
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 70/357 (20%)
APH <214..329 CDD:279908 31/117 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459615
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.