DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31099 and CG31380

DIOPT Version :9

Sequence 1:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_733121.1 Gene:CG31380 / 318701 FlyBaseID:FBgn0051380 Length:405 Species:Drosophila melanogaster


Alignment Length:417 Identity:103/417 - (24%)
Similarity:179/417 - (42%) Gaps:69/417 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VSSLSLNQAVHSVLEDGVQITSVIPSVHLIQFRNCTVLLPIQVKVQLRDFTMKKLFFLLKAQHGT 74
            |.|:.:|.|    |..|....:::..:||:........|..:..::..|...|    :.||.:  
  Fly    25 VESMVINPA----LGKGENYGAILTRIHLVYSSIVEEHLIAKTVLEYEDAETK----MKKAPY-- 79

  Fly    75 DIQAMVMNQLKMFQREHQVYHNVLPKLEEIYREVGKKVSFGPRAFRLDYSIGVQYVLLEDLKAKS 139
            ||          :.||.::|..|||||:|:   .|:::.  |:...:|...|.  :::|||..|.
  Fly    80 DI----------YNRELEIYEQVLPKLQEL---AGEQLC--PKILHIDRQRGA--LIMEDLSYKG 127

  Fly   140 YKNVERQAGFNKLCLKQVLKKLAQFHAASAVCVEKHGAFSNLLVN---------GVYTKANESVL 195
            :....|....::..:..||:|||:..|||||..      :|||.|         |.:.:..||. 
  Fly   128 FVMAPRLQRLDEQHVSLVLRKLAKMQAASAVLE------NNLLENNFSLTEYDKGFFNRYTESF- 185

  Fly   196 QELNDPEIFLSQLR------RWRLGDHFHKRLVEKEKDLVDGL-LKLHSPDSNEFNVLNHSDCWV 253
                 ...||..|:      :.:.|...|.:|:::......|| |:....:....|||.|.|.|.
  Fly   186 -----SAYFLGCLKSCANYLKTQAGYEHHAKLLDELAPYYMGLGLRCFKQEQTHINVLTHGDLWT 245

  Fly   254 NNVMFKFDDSGHVEDTALLDYQLVKYGSPAIDLYYTILSSAEKDIKLAQFDNMVQYYFYHLLDNL 318
            ||:|||: ::|...|..|:|:|...:|||.:|:::.:.:||.:.::......|...|....:..|
  Fly   246 NNMMFKY-EAGVPSDVLLIDFQYAFWGSPTLDIHHLLNTSAVEQVRSELQMKMRGVYHDVFVGEL 309

  Fly   319 KALNFGGS-LPQLQHIRDALNKNGLAAYVVVTRALPITMMNQFEDEVNERYAS---------KMK 373
            :.|.|.|. ||..:.......:....|.......||: ::|  .||.:..:|:         .||
  Fly   310 QRLGFKGQRLPSRKQFHLESEQKRFYAVHCGLLLLPV-LLN--TDETDADFAALLSDQPRGMDMK 371

  Fly   374 CAMFTSRKYIQAIKDILPWMEERSLLN 400
            ..::.:.....:||.::...|...||:
  Fly   372 RRLYLNPGIQDSIKQMVKHFELEGLLD 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 77/294 (26%)
CG31380NP_733121.1 EcKinase 36..314 CDD:281023 80/313 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459434
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.