DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31099 and CG31288

DIOPT Version :9

Sequence 1:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_733094.1 Gene:CG31288 / 318664 FlyBaseID:FBgn0051288 Length:428 Species:Drosophila melanogaster


Alignment Length:418 Identity:113/418 - (27%)
Similarity:204/418 - (48%) Gaps:34/418 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IPDWVSSLSLNQAVHSVLEDGVQITSVIPSVHLIQFRNCT-VLLPIQVKVQLRDFTMKKLFFLLK 69
            ||||::.......:.....|.|::........:....|.| .:|.:.:|::::|.::|...::.|
  Fly    16 IPDWINEKYFESVLAKDEPDHVKVLKFTVVAAIPPGENFTSTMLRVYIKLEMKDGSVKTKTYIFK 80

  Fly    70 A-----QHGTDIQAMVMNQLKMFQREHQVYHNVLPKLEEIYREVGKKVSFGPRAFRLDYSIGVQY 129
            .     :.|:||     |:..:|.:|..:|...||..|.:|::||..:...|:....:...|..:
  Fly    81 TMLPEERGGSDI-----NEFGLFPKEAMMYKTYLPAFEALYKDVGWDIQLAPKCLHTEEREGDIH 140

  Fly   130 VLLEDLKAKSYKNVERQAGFNKLCLKQVLKKLAQFHAASAVCVEKHGAFSNLLVNGVYTK----- 189
            .:.|||..|.:||::|..|.:...:.:.|:|||::||||||..|.||.:.:....|...|     
  Fly   141 FIFEDLCVKRFKNMDRTKGLDMEHMTKCLQKLAEYHAASAVYEELHGPYPSEFSEGFVKKDVKKF 205

  Fly   190 -ANESVLQELNDPEIFLSQLRRWRL--GDHFHKRLVEKEKDLVDGLLKLH-SPDSNEFNVLNHSD 250
             .:...|:|....:..||    |.|  .|.:.|.....::.....|..|. :||  ||:||||.|
  Fly   206 HVDGFQLKEKAYKKAMLS----WGLKDADKYIKAFPTVKQYWAQCLSTLELNPD--EFHVLNHGD 264

  Fly   251 CWVNNVMFKFDDSGHVEDTALLDYQLVKYGSPAIDLYYTILSSAEKDIKLAQFDNMVQYYFYHLL 315
            .|.:|:|..:...|.:|...|:|:|:|.:||||:||.:.:..|...|:::.:||:.|:.|:..|:
  Fly   265 FWSSNLMSSYLPDGTLEKLILIDFQIVMWGSPAMDLLFFLTLSPTNDLRIKEFDHFVRIYWERLV 329

  Fly   316 DNLKALNFGGSLPQLQHIRDAL-NKN-GLAAYVVVTRALPITMMNQFED------EVNERYASKM 372
            :.||.|.....||:|:.::::: ||| ...|:..:...|||.:....:|      ..|.......
  Fly   330 ECLKVLKLKKPLPKLRDLQNSMNNKNHSFYAFFSILNHLPIILFPTDKDSNIHNLSANTEEGENY 394

  Fly   373 KCAMFTSRKYIQAIKDILPWMEERSLLN 400
            :..:.::..:...:||:.|::..|.:||
  Fly   395 RLRLLSNPAFGNVMKDLYPFLYNRGILN 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 88/293 (30%)
CG31288NP_733094.1 EcKinase 50..331 CDD:281023 86/291 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442556
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I6344
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D27900at6960
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.