DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31099 and CG32195

DIOPT Version :9

Sequence 1:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001262006.1 Gene:CG32195 / 317907 FlyBaseID:FBgn0052195 Length:401 Species:Drosophila melanogaster


Alignment Length:424 Identity:112/424 - (26%)
Similarity:184/424 - (43%) Gaps:93/424 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 NQAVHSVLEDGVQITSVIPSVHLIQFRNCTVLLPIQVKVQLRDFTMKKLFFLLK------AQHGT 74
            |..:.:|.:.|....|||..|.|: ||...            |..::...::||      |..||
  Fly    28 NFHIKAVSQKGENFCSVIYRVALV-FRRSP------------DGALESGKYILKDLLPAAAALGT 79

  Fly    75 DIQAMVMNQLKMFQREHQVYHNVLPKLEEIYREVGKKV---SFGPRAFRLDYSIGVQYVLLEDLK 136
            :              |..::..:||.::.|..|..|::   ........::.|.|.:..:||||.
  Fly    80 N--------------EKDMFEVLLPAMQAILEEAPKEIGEHKLSADCLLVEISAGKELYILEDLG 130

  Fly   137 AKSYKNVERQAGFN----KLCLKQVLKKLAQFHAASAVCVEK-----------HGA------FSN 180
            |..|::.:|:.|.|    |:|    ::||||||.||.|..||           |.|      |:.
  Fly   131 ALGYESFDRRQGLNLEEAKIC----VRKLAQFHGASKVLYEKKPELIQRLSPSHYANGLNDRFAQ 191

  Fly   181 LLVNGVYTKANESVLQELNDPEIFLSQLRRWRLGDHFHKRLVEKEKDLVDGLLKLHSPDSNEFNV 245
            .||......|.|:..:||  |||  |:..:.::...:.||:    :|:||       |:.:..|.
  Fly   192 ALVLEGAEYAAEAFAEEL--PEI--SKKMKAQIPKAYTKRM----RDVVD-------PNKSSLNA 241

  Fly   246 LNHSDCWVNNVMFKFDDSGHVEDTALLDYQLVKYGSPAIDLYYTILSSAEKDIKLAQFDNMVQYY 310
            :.|.|.|:||:||.|.:    :...|:|:|...:||||||||:...:|.:.::.|...|.::.||
  Fly   242 VIHGDPWLNNIMFDFVN----KKATLVDFQNCYWGSPAIDLYFLFYTSLKPELLLNNQDELLNYY 302

  Fly   311 FYHLLDNLKALNFGGSLPQLQHIRDALNKNGLAAYVVVTRALPITM----------MNQFEDEVN 365
            |.:||:.|:...:..:||....::|.:.:.....|..|...|||..          ::.|   |:
  Fly   303 FDNLLETLRHCGYKDTLPTFGQLKDEMKRCLFYGYYTVVCELPICCASPEASVDFGVHTF---VD 364

  Fly   366 ERYASKMKCAMFTSRKYIQAIKDILPWMEERSLL 399
            .....|.:..:|.|.:..|.||..|...:...:|
  Fly   365 TDAMLKKRHQLFASERVRQTIKATLLMFDREGIL 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 84/308 (27%)
CG32195NP_001262006.1 EcKinase 37..315 CDD:281023 92/327 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459482
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.