DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31099 and T16G1.6

DIOPT Version :9

Sequence 1:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_506234.2 Gene:T16G1.6 / 188554 WormBaseID:WBGene00011800 Length:431 Species:Caenorhabditis elegans


Alignment Length:349 Identity:77/349 - (22%)
Similarity:142/349 - (40%) Gaps:87/349 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 MFQREHQVYHN------VLP----KLEEIYREVGKKVSFGPR---AFRLDYSIGVQYVLLEDLKA 137
            ||:.|.|..||      ||.    |.||:   :..|:.|..:   ..:|...:|::||  :|:..
 Worm   110 MFENEAQHLHNREVNFYVLAEKWNKPEEL---LNAKIFFSKKFDSENKLKGFLGMEYV--DDVTI 169

  Fly   138 KS-YKNVERQAGFNKLCLKQVLKKLAQFHAASA-VCVEKHGAFSNL--------LVNGVYTKANE 192
            :. |.|::...      |..|||.:||..|.|. :..|:..:.|..        :.|....|.|.
 Worm   170 RHLYCNLKPYE------LHPVLKAVAQLQAESLHLSDEELQSISGFDFKQMMGTMFNDDGLKGNY 228

  Fly   193 SVLQELNDPEIFLSQLRRWRLGDHFHKRLVEKEKDLVD--GLLKLHSPDSNEFN--------VLN 247
            ...:::| ||                 ||.|| .|:|:  |:..::...:...|        ||.
 Worm   229 KQTRDIN-PE-----------------RLKEK-TDIVEAFGMEVVNFEFAGNLNKVVGIHKDVLV 274

  Fly   248 HSDCWVNNVMFKFDDSGHVEDTALLDYQLVKYGSPAIDL---YYTILSSAEKDIKLAQFDNMVQY 309
            |.|.|..|:::..:| |....:.::|||::..|:||.||   :...||.|::.   |.::.:::.
 Worm   275 HGDLWAANILWNEND-GKFSASKVIDYQIIHMGNPAEDLVRVFLCTLSGADRQ---AHWEKLLEQ 335

  Fly   310 YFYHLLDNLKALNFGGSLPQLQHIRDALNKNGLAAYVVVTRALPITMMNQFEDEVNERYASKMKC 374
            ::.:.|:.|:......:|.||        |.....|.|....:.:.:....         ::.|.
 Worm   336 FYEYFLEALEDNEIPYTLDQL--------KESYRLYFVTGSLVMLPLYGPI---------AQTKL 383

  Fly   375 AMFTSRKYIQAIKDILPWMEERSL 398
            :.....::::..::||....|:.|
 Worm   384 SYSKDTEHVEEYREILTEKAEKLL 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 66/272 (24%)
T16G1.6NP_506234.2 DUF1679 8..417 CDD:369592 77/349 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.