DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31099 and F48G7.12

DIOPT Version :9

Sequence 1:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_503277.2 Gene:F48G7.12 / 186000 WormBaseID:WBGene00018623 Length:435 Species:Caenorhabditis elegans


Alignment Length:282 Identity:61/282 - (21%)
Similarity:111/282 - (39%) Gaps:69/282 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 MFQREHQVYHNVLPKLEEIYREVGK-------KVSF-----------GPRAFRLDYSIGVQYVLL 132
            :|:.|.|..||....|.:|..:..|       |:.|           |......|.::.|:::  
 Worm   113 IFENEAQKLHNREVNLYKITEKWNKNETMLSPKIYFYKKFDAENKTKGILGMEFDGNVTVRHI-- 175

  Fly   133 EDLKAKSYKNVERQAGFNKLCLKQVLKKLAQFHAASA-VCVEKHGAFSNL--------LVN---- 184
                   |.||:.:.      |..||:.:|...|.|. :..::..:.|.|        |:|    
 Worm   176 -------YCNVKPRE------LYPVLRSIATLQAGSLHLTKDEIESISGLDVKQMMGSLMNNEGM 227

  Fly   185 -GVYTKANE----SVLQELNDPEIFLSQLRRWRLGDHFHKRLVEKEKDLVDGLLKLHSPDSNEFN 244
             |.|.:..|    .:.::.|..|.|..::..:.|..:.:|.:..|.                  :
 Worm   228 KGFYEQTREINRKRLTEKTNVVEAFGQEVVNFELACNLNKYIGIKR------------------D 274

  Fly   245 VLNHSDCWVNNVMFKFDDSGHVEDTALLDYQLVKYGSPAIDLYYTILSSAEKDIKLAQFDNMVQY 309
            |:.|.|.|..|:::|..|.|....:.::||||:..|:||.||....||:.....:.|.::.:::.
 Worm   275 VMVHGDLWAANILWKEKDEGTFSVSKVIDYQLIHMGNPAEDLVRLFLSTLSGADRQAHWERLLEK 339

  Fly   310 YFYHLLDNLKALNFGGSLPQLQ 331
            ::.:.|..|.......||.||:
 Worm   340 FYTYFLAALGDDEAPYSLEQLK 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 57/272 (21%)
F48G7.12NP_503277.2 DUF1679 10..421 CDD:369592 61/282 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.