DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31099 and C29F7.1

DIOPT Version :9

Sequence 1:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001379235.1 Gene:C29F7.1 / 183016 WormBaseID:WBGene00007810 Length:394 Species:Caenorhabditis elegans


Alignment Length:324 Identity:75/324 - (23%)
Similarity:123/324 - (37%) Gaps:72/324 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 KVQLRDFTMKKLFFLLKAQHGT---------DIQAMVMNQLKMFQREHQVYHNVLPKLEEIYREV 108
            |..|.|...||:.  :|.:.|:         ...:|:......|..|.::.|..|||...|....
 Worm    13 KEWLADLVKKKIG--VKPKVGSCGILDNADLGFMSMIRKVQLHFDAEQELKHPNLPKNVVIKIAS 75

  Fly   109 GKKVSFGPRAFRLDYSIGVQYVLLEDLKAK---SYKNVERQAGFNKLCLK-QVLKKLAQFHAASA 169
            ..|:..|..:..:|.:.|....::|.....   :|.||.|:  :..|.:| .|:...|:...|.|
 Worm    76 CAKLGEGVGSVGVDVNKGNAAAIMELFMHNTECNYYNVFRK--YTDLPMKVPVIYCAAKAGDAEA 138

  Fly   170 -VCVEKHGAFSNL----LVNGVYTKANESVLQELNDPEIFLSQLRRWR--LGDHFHKRLVEKEKD 227
             |.|.....|.:.    |::|........::.|:.:..||......||  |.|...:..|    |
 Worm   139 PVPVIVMEMFEDCTVHDLIDGFDKDQLFKIVDEIVNLHIFSLTTEEWRSVLPDSAMRDTV----D 199

  Fly   228 LVDGLLK------LHSPD----------------------SNEF------NVLNHSDCWVNNVMF 258
            |.:.::|      ..||.                      |:|:      :||.|.|.|...:::
 Worm   200 LFEAMVKTIAENMAKSPGLEIISKYIEKTFDKDPSFMTKFSDEYLEGKRKSVLTHGDLWSPQILW 264

  Fly   259 KFDDSGHVEDTALLDYQLVKYGSPAIDLYYTILS---SAEKDIKLAQFDNMVQYYFYHLLDNLK 319
            ..||:    ...::|:|:...|||..|| :.|||   |.|...||.:  .::.:||..|...|:
 Worm   265 DKDDN----IAGIIDWQVGHQGSPMEDL-HRILSTGTSVENRNKLTK--PLLDHYFEKLSAGLE 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 75/324 (23%)
C29F7.1NP_001379235.1 CHK 142..322 CDD:214734 44/191 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.