DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31099 and F58B4.5

DIOPT Version :9

Sequence 1:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_505788.1 Gene:F58B4.5 / 179513 WormBaseID:WBGene00010238 Length:423 Species:Caenorhabditis elegans


Alignment Length:420 Identity:87/420 - (20%)
Similarity:161/420 - (38%) Gaps:106/420 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PDWVSSLSLNQAVHSVLEDGVQITSVIPSVHLIQFRNCTVLLPIQVKVQLRDFTMKKLFFLLKAQ 71
            |.||.:....:.....:   |:|:|.:|.:.:               .:|.||:....|:     
 Worm    58 PKWVGASENEELPEKFV---VKISSQLPFIEM---------------TKLMDFSSGDEFW----- 99

  Fly    72 HGTDIQAMVMNQLK--MFQREHQVYHNVLPKLEEIYREVGKKVSF----GPRAFRLDYSIGVQYV 130
              .|.:...|.::.  :..||...|       :.:.||...|:.|    ..:.|.          
 Worm   100 --DDAKLKGMGEVTRLLHNREVATY-------KILMREKHPKIPFTKVYASKPFD---------- 145

  Fly   131 LLEDLKAKSYKNVERQAGFNKLCLKQ---------VLKKLAQFHAASAVCVEK-----HGAFSNL 181
              ::.|.|:|...|.....:.:.:.:         |:..:|.|.|......|:     .||....
 Worm   146 --DENKLKAYLISEYYPNIHHIGMHESIPAEDLIPVIHAIAAFSAIGMKLSEEETKYARGADFLD 208

  Fly   182 LVNGVY--TKANE--SVLQELNDPEIFLSQ----LRRWRLGDHFHKRLVEKEKDLVD--GLLKLH 236
            :|.|.:  .|:.|  :||.:.:.||.:|.:    |:.:: ..:|..::::..|:...  |    :
 Worm   209 IVFGQFMDEKSIERMNVLLKASFPEEYLEKVEEMLKIYK-DYYFQPQMIKNFKNTCQFFG----Y 268

  Fly   237 SPDSNEFNVLNHSDCWVNNVMFKFDDSGHVEDTALLDYQLVKYGSPAID---LYYTILSSAEKDI 298
            .|      ||.|||.|.:|.:.. .|...|...|::|:|.|...:||.|   |:.:.||:.::..
 Worm   269 KP------VLTHSDLWSSNFLCT-RDGEKVTLKAIIDFQTVSITTPAQDVGRLFASCLSTKDRRE 326

  Fly   299 KLAQFDNMVQYYFYHLLDNLKALNFGGSLPQLQHIRDALNKNGLAAY--VVVTRALP-ITMMNQF 360
            |.   |.:::.|:...::.|..::...:..||        |:....|  ::.|..|| |..|.| 
 Worm   327 KA---DFLLEEYYNTFVNELDGMDVPYTFQQL--------KDSYQVYFPLMTTMVLPGIAPMLQ- 379

  Fly   361 EDEVNERYASKMKCAMFTSRKYIQAIKDIL 390
            ...|.|.|...||  .....|.|..::|::
 Worm   380 HSNVTEEYKDSMK--QVALDKMIGLLEDVI 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 62/311 (20%)
F58B4.5NP_505788.1 DUF1679 3..414 CDD:369592 87/420 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.