DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tau and 4930480E11Rik

DIOPT Version :9

Sequence 1:NP_733224.2 Gene:tau / 326116 FlyBaseID:FBgn0266579 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_001171437.1 Gene:4930480E11Rik / 74910 MGIID:1922160 Length:394 Species:Mus musculus


Alignment Length:177 Identity:37/177 - (20%)
Similarity:67/177 - (37%) Gaps:14/177 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PQDYPVQQQRAQSKSEYVMNSASVDRPQQQSRPQPTQDYVPFESSDSSVERKKEQP--SAQLSTD 78
            |:..||.:.:.:.::.............|:.....|.||.|.|...|...:....|  |.:||:.
Mouse    15 PRCKPVLKHKTEQQTSTPFMEDHHQHFSQEELDDFTTDYEPHEEISSQTIQGTVFPRISHKLSST 79

  Fly    79 YTNSN---TTSDSASYGSDSVSKQQIRSQQNPEYQNNAYEAPRDDRSQL------QPQRSQPATD 134
            .|..|   ...|...:.|.|:.:|.||   .|:|:.:......||..:.      ||:..|....
Mouse    80 ATKMNQRKLPKDLGLFSSISMGQQGIR---RPQYKLDHLSQMEDDAEEYSINLKEQPKCDQNLKK 141

  Fly   135 YSAYERQQRPPPTTLDYTTGYNAPPKDRTTLSRTNSRPTLSSPNPKL 181
            :.:::.:.:....:......:|..|.:.:.|.:....||.:|.|..|
Mouse   142 WPSFKNKMKVNKNSKHGKKLHNLHPPENSRLGQKKFLPTHTSRNKNL 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tauNP_733224.2 Tubulin-binding 521..551 CDD:278828
Tubulin-binding 583..610 CDD:278828
Tubulin-binding 613..642 CDD:278828
Tubulin-binding 644..672 CDD:278828
4930480E11RikNP_001171437.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838318
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.