DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tau and zgc:158260

DIOPT Version :9

Sequence 1:NP_733224.2 Gene:tau / 326116 FlyBaseID:FBgn0266579 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_001073522.1 Gene:zgc:158260 / 571389 ZFINID:ZDB-GENE-061201-24 Length:364 Species:Danio rerio


Alignment Length:300 Identity:61/300 - (20%)
Similarity:100/300 - (33%) Gaps:93/300 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 QLQQQQQQQQQ----QQHMQQQQQLRPLSAASAHNNNDDDDDVVMGP-AVTPLKTFNSRPDPMGE 412
            :||:::..:.|    :|::|.|.|...:.|.        :..:...| |:.|.......|: :.|
Zfish    80 KLQRKKLSKNQVCYSKQNLQSQTQREFIDAV--------EHKLKQHPLALYPHLESGMIPE-LFE 135

  Fly   413 PLLEDIEPPFQTSPPAGESKKGPGFKGDNDSGVDESTQEKDRNGPNSPSSPVKTPTSTSSKPDKS 477
            .:|..::|..........:||......|..:..:.||||           .:|..||..|..|:|
Zfish   136 QVLSVLDPDMCMKGELSLTKKTEKHLEDRRAKCEVSTQE-----------ILKRSTSIKSPKDES 189

  Fly   478 GTSRPPSATPSNKSAPKSRSASKNRLLLKTPEPEPVKKVPMNKVQVGHAPSPN------LKAVRS 536
            ..:|..:|                   .|..|.:.:.|    :.|..:|....      :|....
Zfish   190 KDTRARNA-------------------YKWQELKEIDK----EYQTANAKQSQEDKQMFVKFFCE 231

  Fly   537 KIGSLDNATYKPGGGHVKIESKKIDIKAAPRIEAKNDKYMPKGGEKKIVTTKLQWNAKSKIGSLE 601
            .|.||        ||...      |::.:..::.....|     |||...|.          .:.
Zfish   232 WITSL--------GGETS------DLRESTILDLFKSDY-----EKKTTLTL----------PIN 267

  Fly   602 NAAHKPGGGDKKIETLKMDFKDKA--------KPKVGSTA 633
            ..||:|.|  |...::|..|||..        |||:..||
Zfish   268 KIAHQPSG--KCHSSVKEHFKDHCVKELTEAYKPKILKTA 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tauNP_733224.2 Tubulin-binding 521..551 CDD:278828 6/35 (17%)
Tubulin-binding 583..610 CDD:278828 5/26 (19%)
Tubulin-binding 613..642 CDD:278828 8/28 (29%)
Tubulin-binding 644..672 CDD:278828
zgc:158260NP_001073522.1 FAM47 31..>144 CDD:291315 14/72 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595927
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.