DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tau and Fam47e

DIOPT Version :10

Sequence 1:NP_733224.2 Gene:tau / 326116 FlyBaseID:FBgn0266579 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_001361643.1 Gene:Fam47e / 384198 MGIID:2686227 Length:402 Species:Mus musculus


Alignment Length:143 Identity:34/143 - (23%)
Similarity:50/143 - (34%) Gaps:46/143 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   395 PAVTPLK---------TFNSRPDPMGEPLLEDIEP-----PFQTSPPAGESKKG----------- 434
            |:.||.|         |..|:....|:..|||:|.     |....|...|:...           
Mouse    84 PSATPEKRQSTLLKGATLLSKLSKAGKAFLEDVEAEAAQHPLTLYPQLTEALPAELLLQVLEVLD 148

  Fly   435 PGFKGDNDSGVDESTQEKDRNGPNSPSSPVKTPTSTSSKPDKSGTSRPPSATPSNKS-------- 491
            |..|.::.....:.|::           |:|.||....|  :|...|||..|..::|        
Mouse   149 PERKLEDVWAYCQDTRK-----------PMKEPTELVGK--RSSQERPPKKTLISRSGQWLCEEK 200

  Fly   492 APKSRSASKNRLL 504
            :.|..|..|:|||
Mouse   201 SSKVDSLYKDRLL 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tauNP_733224.2 PHA03247 <113..529 CDD:223021 34/143 (24%)
Tubulin-binding 521..551 CDD:459807
Tubulin-binding 582..610 CDD:459807
Tubulin-binding 612..642 CDD:459807
Tubulin-binding 644..672 CDD:459807
Fam47eNP_001361643.1 FAM47 26..>185 CDD:405345 25/113 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.