DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tau and Nf-YB

DIOPT Version :9

Sequence 1:NP_733224.2 Gene:tau / 326116 FlyBaseID:FBgn0266579 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_001286089.1 Gene:Nf-YB / 35261 FlyBaseID:FBgn0032816 Length:156 Species:Drosophila melanogaster


Alignment Length:95 Identity:22/95 - (23%)
Similarity:37/95 - (38%) Gaps:17/95 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IISPQDYPVQQQRAQSK----------SEYV--MNSASVDRPQQQSRPQPTQDYVPFESSDSSVE 65
            ||.....||.|....:|          ||::  ::|.:::|...::|.....|.:....|:...:
  Fly    48 IIKIMKVPVPQNGKIAKDARECIQECVSEFISFISSEAIERSVAENRKTVNGDDLLVAFSNLGFD 112

  Fly    66 RKKEQPSAQLSTDYTNSNTTSDS----ASY 91
            ...|..|..|. .|..||.:..:    |||
  Fly   113 NYVEPLSIYLQ-KYRESNKSDRNLFLDASY 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tauNP_733224.2 Tubulin-binding 521..551 CDD:278828
Tubulin-binding 583..610 CDD:278828
Tubulin-binding 613..642 CDD:278828
Tubulin-binding 644..672 CDD:278828
Nf-YBNP_001286089.1 CBFD_NFYB_HMF 42..105 CDD:279185 12/56 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450779
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.