DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tau and Nf-YB

DIOPT Version :10

Sequence 1:NP_733224.2 Gene:tau / 326116 FlyBaseID:FBgn0266579 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_609997.1 Gene:Nf-YB / 35261 FlyBaseID:FBgn0032816 Length:156 Species:Drosophila melanogaster


Alignment Length:95 Identity:22/95 - (23%)
Similarity:37/95 - (38%) Gaps:17/95 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IISPQDYPVQQQRAQSK----------SEYV--MNSASVDRPQQQSRPQPTQDYVPFESSDSSVE 65
            ||.....||.|....:|          ||::  ::|.:::|...::|.....|.:....|:...:
  Fly    48 IIKIMKVPVPQNGKIAKDARECIQECVSEFISFISSEAIERSVAENRKTVNGDDLLVAFSNLGFD 112

  Fly    66 RKKEQPSAQLSTDYTNSNTTSDS----ASY 91
            ...|..|..|. .|..||.:..:    |||
  Fly   113 NYVEPLSIYLQ-KYRESNKSDRNLFLDASY 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tauNP_733224.2 PHA03247 <113..529 CDD:223021
Tubulin-binding 521..551 CDD:459807
Tubulin-binding 582..610 CDD:459807
Tubulin-binding 612..642 CDD:459807
Tubulin-binding 644..672 CDD:459807
Nf-YBNP_609997.1 HFD_NFYB 36..126 CDD:467032 16/78 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.