DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tau and NC2beta

DIOPT Version :10

Sequence 1:NP_733224.2 Gene:tau / 326116 FlyBaseID:FBgn0266579 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_609736.1 Gene:NC2beta / 34875 FlyBaseID:FBgn0028926 Length:183 Species:Drosophila melanogaster


Alignment Length:52 Identity:20/52 - (38%)
Similarity:30/52 - (57%) Gaps:7/52 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   346 QQQQPPQQLQQQQQQQQQQQHMQQQQ----QLRPL---SAASAHNNNDDDDD 390
            |||:...:.:::|.:::|||.|..|.    |..||   |.||..:.:|||||
  Fly   128 QQQELFAKAREEQAREEQQQWMSMQAAAMVQRPPLADGSVASKPSEDDDDDD 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tauNP_733224.2 PHA03247 <113..529 CDD:223021 20/52 (38%)
Tubulin-binding 521..551 CDD:459807
Tubulin-binding 582..610 CDD:459807
Tubulin-binding 612..642 CDD:459807
Tubulin-binding 644..672 CDD:459807
NC2betaNP_609736.1 HFD_Dr1 15..135 CDD:467030 3/6 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.