DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tau and nfyb-1

DIOPT Version :10

Sequence 1:NP_733224.2 Gene:tau / 326116 FlyBaseID:FBgn0266579 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_493740.1 Gene:nfyb-1 / 173435 WormBaseID:WBGene00021132 Length:403 Species:Caenorhabditis elegans


Alignment Length:128 Identity:32/128 - (25%)
Similarity:53/128 - (41%) Gaps:21/128 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SGQEI--ISPQDYPVQQQRAQSKSEYVMN---SASVDRPQQQSRPQPTQDYVPFESSDSSVERK- 67
            :|.|:  :..||.|:|.:.....:::|||   ..::.....|..|||.        |.|||.|| 
 Worm   284 NGMELYPLIIQDTPLQLENVSGPNQFVMNMPDGRAIPHGMGQEEPQPV--------SSSSVMRKI 340

  Fly    68 KEQPSAQLSTDYTNSNTTS-DSASYGSDSVSKQQIRSQQNPEYQNNAYEAPRDDRSQLQPQRS 129
            .:.||:.....:..|:... |...| .:.....|:.....|     ...|||...:::||:|:
 Worm   341 GQNPSSYAQQHHHVSHVEQHDDVEY-EEEEEVDQVEEDTVP-----VPIAPRPAATRVQPKRT 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tauNP_733224.2 PHA03247 <113..529 CDD:223021 6/17 (35%)
Tubulin-binding 521..551 CDD:459807
Tubulin-binding 582..610 CDD:459807
Tubulin-binding 612..642 CDD:459807
Tubulin-binding 644..672 CDD:459807
nfyb-1NP_493740.1 HFD_NFYB 61..149 CDD:467032
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.