DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tau and LOC100909677

DIOPT Version :9

Sequence 1:NP_733224.2 Gene:tau / 326116 FlyBaseID:FBgn0266579 Length:717 Species:Drosophila melanogaster
Sequence 2:XP_003752094.1 Gene:LOC100909677 / 100909677 RGDID:6502369 Length:396 Species:Rattus norvegicus


Alignment Length:401 Identity:73/401 - (18%)
Similarity:141/401 - (35%) Gaps:114/401 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 RPPFNQPPMQPQQQQPPQQLQQQQQQQQQQQHMQQ--QQQLRPLSAASAHNNNDDDDDVVMGP-- 395
            |.|.||||..|..:...:...:|......:.|.||  |::|...:     ...:..::::.|.  
  Rat     5 RMPENQPPQLPSYKHVLKHKTEQLSSPFMENHYQQFSQEKLGDFT-----RYYEPHEEILSGTIR 64

  Fly   396 -AVTPLKTFNSRPDPMGEPLLEDIEPPFQTSPPAGESKKG---PGFKGDNDSGVDESTQEKDRNG 456
             .|.| :..:..|..:.:.....::..|:........::|   ..:|.|:.|..::..:|...|.
  Rat    65 GTVFP-RISHKVPSTLTKMNQRKLQQDFRMFCSISIGQQGIRRTQYKWDHLSQTEDDAKEYVINL 128

  Fly   457 PNSP------------SSPVKTPTSTSSKPDKSGTS---RPPSATPSNKSAPKSRSASKNRLLLK 506
            ...|            .:.:|     ::|.:|.|.:   :.....|.|     ||...||.|...
  Rat   129 KEQPKCDQNLNKWYCFENQIK-----ANKNNKQGENIHKKLNLRLPGN-----SRLGQKNFLPAY 183

  Fly   507 TPEPEPVKKVPMNKVQVGHAP--SPNLKAVRSKIGSLDNATYKPGGGHVKIESKKIDIKAAPRIE 569
            |...:.:    ::.:...:|.  |.|:......:|:||           ..:...:|....|..:
  Rat   184 TFRNQNL----LDSLSCRYAQGGSDNIYDWNEALGNLD-----------VFQQFDMDYANQPTYD 233

  Fly   570 AKNDK---YMP------KG--GEKKIVTTKLQWNAKSKIGSLENAAHKPGGGDKKIETLKMDFKD 623
            ..:||   ::|      :|  .||.|..:|.....::|:.:..|              |.|..|:
  Rat   234 EFSDKIISHLPSKLKYFRGLTKEKGIKFSKQISKFETKVQNQHN--------------LSMSTKE 284

  Fly   624 KAKPKVGSTANVKHQPGGGDIKIQTQKL-EIKAQSKVGSLDNVKHKPGGGEKKIFD-------DK 680
            |          .|::|       ..||| ::|.|:        ..:|..|.|.:.:       :.
  Rat   285 K----------FKYEP-------SYQKLKQLKTQA--------VRQPLNGSKNLLEIEGKSICEP 324

  Fly   681 DYLKNVEHSVA 691
            |.|:|:..::|
  Rat   325 DLLENLYGAIA 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tauNP_733224.2 Tubulin-binding 521..551 CDD:278828 6/31 (19%)
Tubulin-binding 583..610 CDD:278828 4/26 (15%)
Tubulin-binding 613..642 CDD:278828 6/28 (21%)
Tubulin-binding 644..672 CDD:278828 6/28 (21%)
LOC100909677XP_003752094.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342108
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.