| Sequence 1: | NP_001138124.2 | Gene: | Atg16 / 326115 | FlyBaseID: | FBgn0039705 | Length: | 612 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001344133.1 | Gene: | Dcaf8 / 98193 | MGIID: | 91860 | Length: | 591 | Species: | Mus musculus |
| Alignment Length: | 447 | Identity: | 91/447 - (20%) |
|---|---|---|---|
| Similarity: | 153/447 - (34%) | Gaps: | 116/447 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 248 NSSPAQFVGGLIGDE---DFDEAAINGAMEAIGLDDNEYISARFTAGEIAENS--RASIDTLKAT 307
Fly 308 GYL-------GQANPTKILMKFEAHENESHAVRWSPVERMVATGGADRKVKLWDIGKNSTEPRAV 365
Fly 366 LSGSSAGINSVDFDSTGAYILGTSNDYGARVWTVMDNRLRHTLTGHSGKVMAAKYVQEPIKVVTG 430
Fly 431 SHDRTLKIWD---------------------------------------------LRSIACIE-- 448
Fly 449 ---TKFAGSSCNDLVTTDSLGSTIISGHYDKKIRFWDIRTEKQADDVLMPAKITSLDLSKDCNYL 510
Fly 511 I-----------CSVRDDTIKLLDLRK------NQVISTFTNEHF-------KISC-----DFAR 546
Fly 547 --ASFNSSGLKIACGS-ADGAIYIWNVNGFL-EATLKGHSTAVNAVSWSPNNNMLAS 599 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Atg16 | NP_001138124.2 | ATG16 | 11..197 | CDD:285778 | |
| SynN | 120..229 | CDD:294095 | |||
| WD40 | 322..605 | CDD:238121 | 75/361 (21%) | ||
| WD40 repeat | 331..368 | CDD:293791 | 5/36 (14%) | ||
| WD40 | <341..612 | CDD:225201 | 71/342 (21%) | ||
| WD40 repeat | 374..410 | CDD:293791 | 10/35 (29%) | ||
| WD40 repeat | 415..453 | CDD:293791 | 9/87 (10%) | ||
| WD40 repeat | 461..491 | CDD:293791 | 8/29 (28%) | ||
| WD40 repeat | 498..536 | CDD:293791 | 12/54 (22%) | ||
| WD40 repeat | 544..579 | CDD:293791 | 12/38 (32%) | ||
| WD40 repeat | 585..609 | CDD:293791 | 4/15 (27%) | ||
| Dcaf8 | NP_001344133.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..140 | 22/123 (18%) | |
| 2A1904 | <17..177 | CDD:273344 | 31/165 (19%) | ||
| Nuclear export signal. /evidence=ECO:0000250|UniProtKB:Q5TAQ9 | 40..51 | 1/10 (10%) | |||
| WD40 | 183..500 | CDD:392136 | 57/275 (21%) | ||
| WD 1 | 185..224 | 10/38 (26%) | |||
| WD40 repeat | 192..228 | CDD:293791 | 6/35 (17%) | ||
| WD 2 | 228..269 | 2/40 (5%) | |||
| WD40 repeat | 234..275 | CDD:293791 | 2/40 (5%) | ||
| WD 3 | 275..315 | 10/40 (25%) | |||
| WD40 repeat | 280..321 | CDD:293791 | 10/45 (22%) | ||
| WD 4 | 323..363 | 8/39 (21%) | |||
| WD40 repeat | 329..377 | CDD:293791 | 11/47 (23%) | ||
| WD 5 | 379..418 | 10/38 (26%) | |||
| WD40 repeat | 384..423 | CDD:293791 | 12/38 (32%) | ||
| WD 6 | 426..466 | 8/27 (30%) | |||
| WD40 repeat | 431..468 | CDD:293791 | 6/22 (27%) | ||
| WD 7 | 470..509 | ||||
| WD40 repeat | 475..499 | CDD:293791 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 552..591 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||