DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg16 and wds

DIOPT Version :9

Sequence 1:NP_001138124.2 Gene:Atg16 / 326115 FlyBaseID:FBgn0039705 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001245503.1 Gene:wds / 53428 FlyBaseID:FBgn0040066 Length:361 Species:Drosophila melanogaster


Alignment Length:331 Identity:92/331 - (27%)
Similarity:155/331 - (46%) Gaps:31/331 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 TAGEIAENSRASID-----TLKATGYLGQANPTKILMKFEAHENESHAVRWSPVERMVATGGADR 348
            |:...:.::::|:.     |||.|              ...|.....||::||....:|:..||:
  Fly    44 TSSNSSASNKSSLSVKPNYTLKFT--------------LAGHTKAVSAVKFSPNGEWLASSSADK 94

  Fly   349 KVKLWDIGKNSTEPRAVLSGSSAGINSVDFDSTGAYILGTSNDYGARVWTVMDNRLRHTLTGHSG 413
            .:|:|  |....:....:||...||:.|.:.|....::..|:|...:||.:...:...||.|||.
  Fly    95 LIKIW--GAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSN 157

  Fly   414 KVMAAKYVQEPIKVVTGSHDRTLKIWDLRSIACIETKFAGSSCNDLVTTDSLGSTIISGHYDKKI 478
            .|....:..:...:|:||.|.:::|||:|:..|::|..|.|.....|..:..||.|:|..||...
  Fly   158 YVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLC 222

  Fly   479 RFWDIRT----EKQADDVLMPAKITSLDLSKDCNYLICSVRDDTIKLLDLRKNQVISTFTNEHFK 539
            |.||..:    :...||...|  ::.:..|.:..|::.:..|:|:||.|..|.:.:.|:|....:
  Fly   223 RIWDTASGQCLKTLIDDDNPP--VSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNE 285

  Fly   540 ISCDFARASFNSSGLK-IACGSADGAIYIWNVNG-FLEATLKGHSTAVNAVSWSPNNNMLASVGK 602
            ..|.|  |:|:.:|.| |..||.|..:||||:.. .:...|:||:..|...:..|..|::||...
  Fly   286 KYCIF--ANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAAL 348

  Fly   603 NKRCTI 608
            ....||
  Fly   349 ENDKTI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg16NP_001138124.2 ATG16 11..197 CDD:285778
SynN 120..229 CDD:294095
WD40 322..605 CDD:238121 84/288 (29%)
WD40 repeat 331..368 CDD:293791 10/36 (28%)
WD40 <341..612 CDD:225201 81/274 (30%)
WD40 repeat 374..410 CDD:293791 8/35 (23%)
WD40 repeat 415..453 CDD:293791 11/37 (30%)
WD40 repeat 461..491 CDD:293791 9/33 (27%)
WD40 repeat 498..536 CDD:293791 10/37 (27%)
WD40 repeat 544..579 CDD:293791 13/36 (36%)
WD40 repeat 585..609 CDD:293791 7/24 (29%)
wdsNP_001245503.1 WD40 64..358 CDD:238121 89/311 (29%)
WD40 repeat 75..112 CDD:293791 10/38 (26%)
WD40 repeat 118..154 CDD:293791 8/35 (23%)
WD40 repeat 159..195 CDD:293791 11/35 (31%)
WD40 repeat 202..237 CDD:293791 10/34 (29%)
WD40 repeat 244..280 CDD:293791 9/35 (26%)
WD40 repeat 288..325 CDD:293791 14/38 (37%)
WD40 repeat 331..357 CDD:293791 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.