DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg16 and CG3436

DIOPT Version :9

Sequence 1:NP_001138124.2 Gene:Atg16 / 326115 FlyBaseID:FBgn0039705 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001285543.1 Gene:CG3436 / 33180 FlyBaseID:FBgn0031229 Length:347 Species:Drosophila melanogaster


Alignment Length:346 Identity:93/346 - (26%)
Similarity:161/346 - (46%) Gaps:45/346 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 IAENSRASIDTLKA----------TGYLGQANPTKILMKFEAHENESHAVRWSPVERMVATGGAD 347
            :|:.::.|.:.|.|          :|....:|....:|:.|.||.|.....:.|...::.:.|.|
  Fly    12 LAQEAKRSKNDLMAYTNRDKALLESGVRRTSNLQAPIMQLEGHEGEIFTAEFHPEGELLLSSGFD 76

  Fly   348 RKVKLWDIGKNSTEPRAVLSGSSAGINSVDFDSTGAYILGTSNDYGARVWTVMDNRLRHTLTGHS 412
            |::.:|.:.::.....| :||.|..:....|...|::|...|.|.....|.:...:.:....||.
  Fly    77 RQIYIWQVYEDCENVMA-MSGHSGAVMEAHFTPDGSHIFTCSTDKTLAFWDIATGQRQRRFKGHG 140

  Fly   413 ---GKVMAAKYVQEPIKVVTGSHDRTLKIWDLR---SIACIETKFAGSSCNDLVTTDSLGST--- 468
               ..|..::..|:  .:.:||.|||:||||.|   :...:|:.|.       ||....|.|   
  Fly   141 NFVNSVQGSRRGQQ--LLCSGSDDRTIKIWDARKKHAAHTLESPFQ-------VTAVCFGDTGEQ 196

  Fly   469 IISGHYDKKIRFWDIRTEKQADDVLMPAK-----ITSLDLSKDCNYLICSVRDDTIKLLDLRK-- 526
            :|||..|.:::.||||  |||  ||...:     ||.:.||.:.::::.:..|:|:::.|:|.  
  Fly   197 VISGGIDNEVKIWDIR--KQA--VLHHLRGHSDTITGMSLSPEGDFILTNAMDNTLRVWDVRPYA 257

  Fly   527 --NQVISTFTNEHFKISCDFARASFNSSGLKIACGSADGAIYIWNVN-GFLEATLKGHSTAVNAV 588
              .:.:..|.........:..|.:::....||..||||..:|||:|| ..:...|.||:.:||||
  Fly   258 PGERCVKVFQGHQHNFEKNLLRCAWSPGSDKITSGSADRHVYIWDVNTRRILYKLPGHNGSVNAV 322

  Fly   589 SWSPNNNMLASVGKNKRCTIY 609
            .:||...::.|...:|  |:|
  Fly   323 DFSPKEPLILSGSSDK--TLY 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg16NP_001138124.2 ATG16 11..197 CDD:285778
SynN 120..229 CDD:294095
WD40 322..605 CDD:238121 83/301 (28%)
WD40 repeat 331..368 CDD:293791 6/36 (17%)
WD40 <341..612 CDD:225201 81/288 (28%)
WD40 repeat 374..410 CDD:293791 6/35 (17%)
WD40 repeat 415..453 CDD:293791 14/40 (35%)
WD40 repeat 461..491 CDD:293791 14/32 (44%)
WD40 repeat 498..536 CDD:293791 9/41 (22%)
WD40 repeat 544..579 CDD:293791 12/35 (34%)
WD40 repeat 585..609 CDD:293791 9/23 (39%)
CG3436NP_001285543.1 WD40 <19..346 CDD:225201 92/339 (27%)
WD40 50..342 CDD:238121 86/308 (28%)
WD40 repeat 58..96 CDD:293791 6/38 (16%)
WD40 repeat 102..138 CDD:293791 6/35 (17%)
WD40 repeat 143..180 CDD:293791 12/38 (32%)
WD40 repeat 186..221 CDD:293791 16/38 (42%)
WD40 repeat 227..267 CDD:293791 8/39 (21%)
WD40 repeat 277..313 CDD:293791 12/35 (34%)
WD40 repeat 319..342 CDD:293791 10/25 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.