| Sequence 1: | NP_001138124.2 | Gene: | Atg16 / 326115 | FlyBaseID: | FBgn0039705 | Length: | 612 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001001940.1 | Gene: | copb2 / 114454 | ZFINID: | ZDB-GENE-010724-7 | Length: | 934 | Species: | Danio rerio |
| Alignment Length: | 260 | Identity: | 59/260 - (22%) |
|---|---|---|---|
| Similarity: | 101/260 - (38%) | Gaps: | 34/260 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 322 FEAHENESHAVRWSPVE-RMVATGGADRKVKLWDIGKNSTEPRAVLSGSSAGINSVDFDSTG--A 383
Fly 384 YILGTSNDYGARVWTVMDNRLRHTLTGHSGKVMAAKYVQEPIKVVTGSHDRTLKIWDLRSIACIE 448
Fly 449 TKFAGSS---CNDLVTTDSLGSTIISGHYDKKIRFWDIRTEKQADDVLMPAKITSLDLSKDCNYL 510
Fly 511 ICSVRDDTIKLLDLRKNQVISTFTNEHFKI------SCDF--ARASFNSSG-LKIACGSADGAIY 566
Fly 567 566 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Atg16 | NP_001138124.2 | ATG16 | 11..197 | CDD:285778 | |
| SynN | 120..229 | CDD:294095 | |||
| WD40 | 322..605 | CDD:238121 | 59/260 (23%) | ||
| WD40 repeat | 331..368 | CDD:293791 | 10/37 (27%) | ||
| WD40 | <341..612 | CDD:225201 | 55/240 (23%) | ||
| WD40 repeat | 374..410 | CDD:293791 | 9/37 (24%) | ||
| WD40 repeat | 415..453 | CDD:293791 | 10/37 (27%) | ||
| WD40 repeat | 461..491 | CDD:293791 | 6/29 (21%) | ||
| WD40 repeat | 498..536 | CDD:293791 | 6/37 (16%) | ||
| WD40 repeat | 544..579 | CDD:293791 | 6/26 (23%) | ||
| WD40 repeat | 585..609 | CDD:293791 | |||
| copb2 | NP_001001940.1 | WD40 | 8..297 | CDD:238121 | 42/164 (26%) |
| WD40 repeat | 19..55 | CDD:293791 | |||
| WD40 | 24..428 | CDD:225201 | 59/260 (23%) | ||
| WD40 repeat | 103..140 | CDD:293791 | 1/1 (100%) | ||
| WD40 repeat | 145..182 | CDD:293791 | 9/38 (24%) | ||
| WD40 repeat | 189..226 | CDD:293791 | 8/36 (22%) | ||
| WD40 repeat | 232..262 | CDD:293791 | 9/29 (31%) | ||
| Coatomer_WDAD | 320..763 | CDD:281977 | 11/59 (19%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||