| Sequence 1: | NP_001138124.2 | Gene: | Atg16 / 326115 | FlyBaseID: | FBgn0039705 | Length: | 612 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_021322228.1 | Gene: | LOC110437943 / 110437943 | -ID: | - | Length: | 284 | Species: | Danio rerio |
| Alignment Length: | 255 | Identity: | 114/255 - (44%) |
|---|---|---|---|
| Similarity: | 157/255 - (61%) | Gaps: | 5/255 - (1%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 359 STEPRAVLSGSSAGINSVDFDSTGAYILGTSNDYGARVWTVMDNRLRHTLTGHSGKVMAAKYVQE 423
Fly 424 PIKVVTGSHDRTLKIWDLRSIACIETKFAGSSCNDLVTTDSLGSTIISGHYDKKIRFWDIRTEKQ 488
Fly 489 ADDVLMPAKITSLDLSKDCNYLICSVRDDTIKLLDLRKNQVISTFTNEHFKISCDFARASFNSSG 553
Fly 554 LKIACGSADGAIYIWNVN-GFLEATLKG-HSTAVNAVSWSPNNNMLASVGKNKRCTIYSE 611 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Atg16 | NP_001138124.2 | ATG16 | 11..197 | CDD:285778 | |
| SynN | 120..229 | CDD:294095 | |||
| WD40 | 322..605 | CDD:238121 | 112/247 (45%) | ||
| WD40 repeat | 331..368 | CDD:293791 | 3/8 (38%) | ||
| WD40 | <341..612 | CDD:225201 | 114/255 (45%) | ||
| WD40 repeat | 374..410 | CDD:293791 | 14/35 (40%) | ||
| WD40 repeat | 415..453 | CDD:293791 | 20/37 (54%) | ||
| WD40 repeat | 461..491 | CDD:293791 | 15/29 (52%) | ||
| WD40 repeat | 498..536 | CDD:293791 | 14/37 (38%) | ||
| WD40 repeat | 544..579 | CDD:293791 | 19/35 (54%) | ||
| WD40 repeat | 585..609 | CDD:293791 | 7/23 (30%) | ||
| LOC110437943 | XP_021322228.1 | WD40 | 35..282 | CDD:238121 | 112/249 (45%) |
| WD40 repeat | 47..83 | CDD:293791 | 14/35 (40%) | ||
| WD40 repeat | 88..124 | CDD:293791 | 20/35 (57%) | ||
| WD40 repeat | 126..162 | CDD:293791 | 19/38 (50%) | ||
| WD40 repeat | 168..206 | CDD:293791 | 14/37 (38%) | ||
| WD40 repeat | 214..254 | CDD:293791 | 20/39 (51%) | ||
| WD40 repeat | 257..281 | CDD:293791 | 7/23 (30%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D265783at33208 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.010 | |||||