DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg16 and fbxw9

DIOPT Version :9

Sequence 1:NP_001138124.2 Gene:Atg16 / 326115 FlyBaseID:FBgn0039705 Length:612 Species:Drosophila melanogaster
Sequence 2:XP_002661149.1 Gene:fbxw9 / 100330184 ZFINID:ZDB-GENE-091204-198 Length:485 Species:Danio rerio


Alignment Length:432 Identity:80/432 - (18%)
Similarity:154/432 - (35%) Gaps:150/432 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 AQFVGGLIGDEDFDEAAINGAMEAIG--------------LDDNEYISARFTAGEIAENSRASID 302
            |.|..|...|.|:..|.:. ..|.||              ::|.:.::|....||..        
Zfish   105 ASFPVGPKQDFDWSRACLE-MEELIGHWKGQGTPTEKQEMVEDRQEVAAEAVNGEAP-------- 160

  Fly   303 TLKATGYLGQANPTKILMKFEAH-----ENESHAVRWSPVERMV--------------------- 341
                   ..:||..::.:..:.:     :|.|.:.. ||:|.||                     
Zfish   161 -------AAEANMVQMQLDVDLNAQIQSQNASSSTS-SPLEHMVLPSGHIADVNCVLLLGGAGAV 217

  Fly   342 -ATGGADRKVKLWDIGKNSTEPRAVLSGSSAGINSVDFDSTGAYILGTSNDYGARVWTVMDNRLR 405
             |:|..||.|.|||:.:.   ||..|..:..|             .||.:.:...||.:      
Zfish   218 CASGSRDRNVNLWDLNEG---PRGALMHTLGG-------------RGTISTHRGWVWCL------ 260

  Fly   406 HTLTGHSGKVMAAKYVQEPIKVVTGSHDRTLKIWDLR-------------SIACIETKFAGSSCN 457
                ..||.::|           :||.|..:|:|||:             ::.|:       ||.
Zfish   261 ----ASSGPLLA-----------SGSFDSMVKLWDLQAGGAERGLIQCKAAVLCL-------SCE 303

  Fly   458 DLVTTDSLGSTIISGHYDKKIRFWDIRTEKQADDVLMPAKITS---LDLSKDCNYLICSVRDDTI 519
                    ..|:::|.:|:::..:|.|.   |:.::...::.|   |.|:.|..:::...:|.::
Zfish   304 --------RDTVLAGSHDQRLSIYDTRA---ANPLVKSLRLHSDAVLCLAADDQFILSGSKDQSV 357

  Fly   520 KLLDLRKNQVISTFTNEHFKISCDFARASFNSSGLKIACGSADGAIYIWNVNGFLEATL---KGH 581
            .|.|.|..:::.......:.:|..|       ||.::..|...|.::.::::......:   |.|
Zfish   358 ALFDRRAGKLLQKVQLSSYLLSVSF-------SGSEVWAGDNRGLLHTFSMSSSCLTPVQQFKTH 415

  Fly   582 STAVNAVSWSPN-----------NNMLASVGKNKRCTIYSES 612
            ::.|..|.::|.           ...|.|......||::.::
Zfish   416 TSLVTGVHYTPGALYTCSSDRSIKIHLPSAPPKTLCTLHHQA 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg16NP_001138124.2 ATG16 11..197 CDD:285778
SynN 120..229 CDD:294095
WD40 322..605 CDD:238121 63/339 (19%)
WD40 repeat 331..368 CDD:293791 16/58 (28%)
WD40 <341..612 CDD:225201 59/322 (18%)
WD40 repeat 374..410 CDD:293791 4/35 (11%)
WD40 repeat 415..453 CDD:293791 9/50 (18%)
WD40 repeat 461..491 CDD:293791 6/29 (21%)
WD40 repeat 498..536 CDD:293791 8/40 (20%)
WD40 repeat 544..579 CDD:293791 5/37 (14%)
WD40 repeat 585..609 CDD:293791 7/34 (21%)
fbxw9XP_002661149.1 WD40 <199..484 CDD:225201 58/321 (18%)
WD40 200..482 CDD:295369 58/320 (18%)
WD40 repeat 258..292 CDD:293791 11/54 (20%)
WD40 repeat 297..332 CDD:293791 9/52 (17%)
WD40 repeat 339..369 CDD:293791 7/29 (24%)
WD40 repeat 409..452 CDD:293791 7/42 (17%)
WD40 repeat 459..481 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.