DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaNE3 and AT1G20270

DIOPT Version :9

Sequence 1:NP_651814.1 Gene:PH4alphaNE3 / 326114 FlyBaseID:FBgn0051017 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_564109.1 Gene:AT1G20270 / 838615 AraportID:AT1G20270 Length:287 Species:Arabidopsis thaliana


Alignment Length:212 Identity:67/212 - (31%)
Similarity:106/212 - (50%) Gaps:33/212 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 EEISLEPHIVVYHDILPDKDIQQLITLAEPLLKPTEMFDDNKNEARSS-YRTPLG-------GPL 355
            |.:|.||...|||:.|..::.:.||:||:|.:..:.:.|....:::.| .||..|       ..:
plant    77 EVLSWEPRAFVYHNFLSKEECEYLISLAKPHMVKSTVVDSETGKSKDSRVRTSSGTFLRRGRDKI 141

  Fly   356 LDSLTQRMRDITGLQIRQGNPINIIKYGFGAPYTNYYDFFKKRNSESKGFGDRMATFMFYLNDAP 420
            :.::.:|:.|.|.:....|..:.::.|..|..|..:||:|....:...| |.||||.:.||:|..
plant   142 IKTIEKRIADYTFIPADHGEGLQVLHYEAGQKYEPHYDYFVDEFNTKNG-GQRMATMLMYLSDVE 205

  Fly   421 YGGATVFPRLNV---KVP-----AERGK------------VLFWYNLNGDTHDMEPTTMHAACPV 465
            .||.||||..|:   .||     :|.||            :||| ::..|. .::||::|..|||
plant   206 EGGETVFPAANMNFSSVPWYNELSECGKKGLSVKPRMGDALLFW-SMRPDA-TLDPTSLHGGCPV 268

  Fly   466 FHGSKWVMTAWIH--EY 480
            ..|:||..|.|:|  ||
plant   269 IRGNKWSSTKWMHVGEY 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaNE3NP_651814.1 P4Ha_N 25..149 CDD:285528
P4Hc 316..478 CDD:214780 56/189 (30%)
AT1G20270NP_564109.1 CASIMO1 <3..38 CDD:420385
PLN00052 79..286 CDD:177683 66/210 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.930

Return to query results.
Submit another query.