DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaNE3 and AT5G18900

DIOPT Version :9

Sequence 1:NP_651814.1 Gene:PH4alphaNE3 / 326114 FlyBaseID:FBgn0051017 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_197391.1 Gene:AT5G18900 / 832008 AraportID:AT5G18900 Length:298 Species:Arabidopsis thaliana


Alignment Length:225 Identity:63/225 - (28%)
Similarity:110/225 - (48%) Gaps:37/225 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 STTSAFLILAPLKMEEISLEPHIVVYHDILPDKDIQQLITLAEPLLKPTEMFDDNKNEAR-SSYR 348
            |::|.|  :.|.|::::|.:|...||...|.:.:...:::||:..||.:.:.|::..|:: |..|
plant    26 SSSSVF--VNPSKVKQVSSKPRAFVYEGFLTELECDHMVSLAKASLKRSAVADNDSGESKFSEVR 88

  Fly   349 TPLG-------GPLLDSLTQRMRDITGLQIRQGNPINIIKYGFGAPYTNYYDFFKKRNSESKGFG 406
            |..|       .|::..:..::...|.|....|..|.:::|..|..|..::|:|..:.:..:| |
plant    89 TSSGTFISKGKDPIVSGIEDKISTWTFLPKENGEDIQVLRYEHGQKYDAHFDYFHDKVNIVRG-G 152

  Fly   407 DRMATFMFYLNDAPYGGATVFPRLNVKVPAER-----------------------GKVLFWYNLN 448
            .||||.:.||::...||.||||  :.::|:.|                       |..|.::||:
plant   153 HRMATILMYLSNVTKGGETVFP--DAEIPSRRVLSENKEDLSDCAKRGIAVKPRKGDALLFFNLH 215

  Fly   449 GDTHDMEPTTMHAACPVFHGSKWVMTAWIH 478
            .|... :|.::|..|||..|.||..|.|||
plant   216 PDAIP-DPLSLHGGCPVIEGEKWSATKWIH 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaNE3NP_651814.1 P4Ha_N 25..149 CDD:285528
P4Hc 316..478 CDD:214780 51/192 (27%)
AT5G18900NP_197391.1 PLN00052 33..298 CDD:177683 60/216 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.930

Return to query results.
Submit another query.