DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaNE3 and AT4G35820

DIOPT Version :9

Sequence 1:NP_651814.1 Gene:PH4alphaNE3 / 326114 FlyBaseID:FBgn0051017 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_195307.1 Gene:AT4G35820 / 829736 AraportID:AT4G35820 Length:272 Species:Arabidopsis thaliana


Alignment Length:253 Identity:60/253 - (23%)
Similarity:100/253 - (39%) Gaps:76/253 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 EAIDSSPKLGEGYK---RLCRSSFSPNPSKLHCRYNSTTSAFLILAPLK------MEEISLEPHI 307
            |.:....|:.|..|   .||  |.||..:.|.|      |...:.|.|:      :|.|:.||..
plant    41 EQVSVDVKIEEKTKDMILLC--SLSPLLTTLTC------SMVKVAASLRFPNERWLEVITKEPRA 97

  Fly   308 VVYHDIL--------PDKDIQQLITLAEPLLKPTEMFDDNKNEARSSYRTPLGG----------- 353
            .|||:.|        .:::...||:||:|.:            |||..|..|.|           
plant    98 FVYHNFLALFFKICKTNEECDHLISLAKPSM------------ARSKVRNALTGLGEESSSRTSS 150

  Fly   354 ---------PLLDSLTQRMRDITGLQIRQGNPINIIKYGFGAPYTNYYDFFKKRNSESKGFGDRM 409
                     .::..:.:|:.:.|.:....|..:.:|.|..|..:..::|.|:           |:
plant   151 GTFIRSGHDKIVKEIEKRISEFTFIPQENGETLQVINYEVGQKFEPHFDGFQ-----------RI 204

  Fly   410 ATFMFYLNDAPYGGATVFP-------RLNVKVPAERGKVLFWYNLNGDTHDMEPTTMH 460
            ||.:.||:|...||.||||       :..|.|..::|..|.::::..| ...:|::.|
plant   205 ATVLMYLSDVDKGGETVFPEAKGIKSKKGVSVRPKKGDALLFWSMRPD-GSRDPSSKH 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaNE3NP_651814.1 P4Ha_N 25..149 CDD:285528
P4Hc 316..478 CDD:214780 38/172 (22%)
AT4G35820NP_195307.1 UBN2_2 3..77 CDD:290927 12/43 (28%)
P4Hc 115..262 CDD:214780 38/171 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1106
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.930

Return to query results.
Submit another query.