DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaNE3 and AT4G33910

DIOPT Version :9

Sequence 1:NP_651814.1 Gene:PH4alphaNE3 / 326114 FlyBaseID:FBgn0051017 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_567941.1 Gene:AT4G33910 / 829535 AraportID:AT4G33910 Length:288 Species:Arabidopsis thaliana


Alignment Length:219 Identity:58/219 - (26%)
Similarity:98/219 - (44%) Gaps:36/219 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 LAPLKMEEISLEPHIVVYHDILPDKDIQQLITLAEPLLKPTEM------FDDNKNEARSSYRTPL 351
            :..:..:.:|..|..:.:.:....:..|.:|..|:..|||:.:      ..:|....|:|..|.:
plant    73 IGSIPFQVLSWRPRAIYFPNFATAEQCQAIIERAKVNLKPSALALRKGETAENTKGTRTSSGTFI 137

  Fly   352 GGP-----LLDSLTQRMRDITGLQIRQGNPINIIKYGFGAPYTNYYDFFKKRNSESKG--FGDRM 409
            ...     .||.:.:::...|.:....|...||::|..|..|.::||.|   |....|  ...|:
plant   138 SASEESTGALDFVERKIARATMIPRSHGESFNILRYELGQKYDSHYDVF---NPTEYGPQSSQRI 199

  Fly   410 ATFMFYLNDAPYGGATVFPRLN---------------VKVPAERGKVLFWYNL--NGDTHDMEPT 457
            |:|:.||:|...||.|:||..|               :||...:|..|.:|::  ||   .::.|
plant   200 ASFLLYLSDVEEGGETMFPFENGSNMGIGYDYKQCIGLKVKPRKGDGLLFYSVFPNG---TIDQT 261

  Fly   458 TMHAACPVFHGSKWVMTAWIHEYD 481
            ::|.:|||..|.|||.|.||.:.|
plant   262 SLHGSCPVTKGEKWVATKWIRDQD 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaNE3NP_651814.1 P4Ha_N 25..149 CDD:285528
P4Hc 316..478 CDD:214780 54/191 (28%)
AT4G33910NP_567941.1 PLN00052 66..287 CDD:177683 58/219 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.930

Return to query results.
Submit another query.