DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaNE3 and AT3G28480

DIOPT Version :9

Sequence 1:NP_651814.1 Gene:PH4alphaNE3 / 326114 FlyBaseID:FBgn0051017 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_001189994.1 Gene:AT3G28480 / 822478 AraportID:AT3G28480 Length:324 Species:Arabidopsis thaliana


Alignment Length:261 Identity:65/261 - (24%)
Similarity:114/261 - (43%) Gaps:48/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 IDSSPKLGEGYKRLCRSSFSPNPSKLHCRYNSTTSAFLILAPLKMEEISLEPHIVVYHDILPDKD 318
            |.|:|.     :.|.|||.:.:.|.:..:.::::..|   .|.::.::|..|.:.:|...|.|::
plant    20 ISSAPN-----RFLTRSSNTRDGSVIKMKTSASSFGF---DPTRVTQLSWTPRVFLYEGFLSDEE 76

  Fly   319 IQQLITLAEPLLKPTEMFDDNKNEA------------RSSYRTPLGGPLLDSLTQ----RMRDIT 367
            ....|.||:..|:.:.:.|::..|:            .||:...:....:|.:..    ::...|
plant    77 CDHFIKLAKGKLEKSMVADNDSGESVESEDSVSVVRQSSSFIANMDSLEIDDIVSNVEAKLAAWT 141

  Fly   368 GLQIRQGNPINIIKYGFGAPYTNYYDFFKKRNSESKGFGDRMATFMFYLNDAPYGGATVFPRLNV 432
            .|....|..:.|:.|..|..|..::|:|..:.:...| |.|:||.:.||::...||.||||....
plant   142 FLPEENGESMQILHYENGQKYEPHFDYFHDQANLELG-GHRIATVLMYLSNVEKGGETVFPMWKG 205

  Fly   433 K------------------VPAERGKVLFWYNL--NGDTHDMEPTTMHAACPVFHGSKWVMTAWI 477
            |                  |...:|..|.::||  |..|   :..::|.:|||..|.||..|.||
plant   206 KATQLKDDSWTECAKQGYAVKPRKGDALLFFNLHPNATT---DSNSLHGSCPVVEGEKWSATRWI 267

  Fly   478 H 478
            |
plant   268 H 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaNE3NP_651814.1 P4Ha_N 25..149 CDD:285528
P4Hc 316..478 CDD:214780 49/197 (25%)
AT3G28480NP_001189994.1 PLN00052 51..324 CDD:177683 57/225 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.930

Return to query results.
Submit another query.