DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaNE3 and P4H2

DIOPT Version :9

Sequence 1:NP_651814.1 Gene:PH4alphaNE3 / 326114 FlyBaseID:FBgn0051017 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_566279.1 Gene:P4H2 / 819804 AraportID:AT3G06300 Length:299 Species:Arabidopsis thaliana


Alignment Length:227 Identity:63/227 - (27%)
Similarity:110/227 - (48%) Gaps:34/227 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 CRYNSTTSAFLILAPLKMEEISLEPHIVVYHDILPDKDIQQLITLAEPLLKPTEMFDDNKNEAR- 344
            |..:|.:|   |:.|.|::::|.:|...||...|.|.:...||:||:..|:.:.:.|::..|:: 
plant    24 CLISSPSS---IINPSKVKQVSSKPRAFVYEGFLTDLECDHLISLAKENLQRSAVADNDNGESQV 85

  Fly   345 SSYRTPLG-------GPLLDSLTQRMRDITGLQIRQGNPINIIKYGFGAPYTNYYDFFKKRNSES 402
            |..||..|       .|::..:..::...|.|....|..:.:::|..|..|..::|:|..:.:.:
plant    86 SDVRTSSGTFISKGKDPIVSGIEDKLSTWTFLPKENGEDLQVLRYEHGQKYDAHFDYFHDKVNIA 150

  Fly   403 KGFGDRMATFMFYLNDAPYGGATVFP---------------------RLNVKVPAERGKVLFWYN 446
            :| |.|:||.:.||::...||.||||                     :..:.|..::|..|.::|
plant   151 RG-GHRIATVLLYLSNVTKGGETVFPDAQEFSRRSLSENKDDLSDCAKKGIAVKPKKGNALLFFN 214

  Fly   447 LNGDTHDMEPTTMHAACPVFHGSKWVMTAWIH 478
            |..|... :|.::|..|||..|.||..|.|||
plant   215 LQQDAIP-DPFSLHGGCPVIEGEKWSATKWIH 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaNE3NP_651814.1 P4Ha_N 25..149 CDD:285528
P4Hc 316..478 CDD:214780 50/190 (26%)
P4H2NP_566279.1 P4Hc 55..245 CDD:214780 50/191 (26%)
ShKT 259..299 CDD:214586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.930

Return to query results.
Submit another query.