DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaNE3 and AT-P4H-1

DIOPT Version :9

Sequence 1:NP_651814.1 Gene:PH4alphaNE3 / 326114 FlyBaseID:FBgn0051017 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_181836.1 Gene:AT-P4H-1 / 818910 AraportID:AT2G43080 Length:283 Species:Arabidopsis thaliana


Alignment Length:222 Identity:59/222 - (26%)
Similarity:101/222 - (45%) Gaps:31/222 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 NSTTSAFLILAPLKMEEISLEPHIVVYHDILPDKDIQQLITLAEPLLKPTEMFDDNKNE-ARSSY 347
            |...:..|.:..:|.|.:|..|.|:|.||.|..::.:.|..:|.|.|:.:.:.|....: .:|..
plant    63 NDKDAELLRIGNVKPEVVSWSPRIIVLHDFLSPEECEYLKAIARPRLQVSTVVDVKTGKGVKSDV 127

  Fly   348 RTPLG---------GPLLDSLTQRMRDITGLQIRQGNPINIIKYGFGAPYTNYYDFFKKRNSESK 403
            ||..|         .|::.::.:|:...:.:....|..|.:::|.....|..::|:|....:..:
plant   128 RTSSGMFLTHVERSYPIIQAIEKRIAVFSQVPAENGELIQVLRYEPQQFYKPHHDYFADTFNLKR 192

  Fly   404 GFGDRMATFMFYLNDAPYGGATVFP---------------RLNVKVPAERGKVLFW-YNLNGDTH 452
            | |.|:||.:.||.|...||.|.||               .::|| |.:...|||| ..|:|.: 
plant   193 G-GQRVATMLMYLTDDVEGGETYFPLAGDGDCTCGGKIMKGISVK-PTKGDAVLFWSMGLDGQS- 254

  Fly   453 DMEPTTMHAACPVFHGSKWVMTAWIHE 479
              :|.::|..|.|..|.||..|.|:.:
plant   255 --DPRSIHGGCEVLSGEKWSATKWMRQ 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaNE3NP_651814.1 P4Ha_N 25..149 CDD:285528
P4Hc 316..478 CDD:214780 48/187 (26%)
AT-P4H-1NP_181836.1 PLN00052 80..281 CDD:177683 55/205 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H94894
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.930

Return to query results.
Submit another query.