DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaNE3 and P4H13

DIOPT Version :9

Sequence 1:NP_651814.1 Gene:PH4alphaNE3 / 326114 FlyBaseID:FBgn0051017 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_850038.1 Gene:P4H13 / 816841 AraportID:AT2G23096 Length:274 Species:Arabidopsis thaliana


Alignment Length:211 Identity:57/211 - (27%)
Similarity:95/211 - (45%) Gaps:37/211 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 ISLEPHIVVYHDILPDKDIQQLITLAEPLLKPTEMF--DDNKNEARSSYRT-------PLGGPLL 356
            :|..|.:....:....:..:.:|.:|:|.|||:.:.  .....|...:||:       ...| :|
plant    71 LSWNPRVFYLPNFATKQQCEAVIDMAKPKLKPSTLALRKGETAETTQNYRSLHQHTDEDESG-VL 134

  Fly   357 DSLTQRMRDITGLQIRQGNPINIIKYGFGAPYTNYYDFFKKRNSESKG--FGDRMATFMFYLNDA 419
            .::.:::...|..........||::|..|..|.::||.|   :|...|  ...|:.||:.:|:..
plant   135 AAIEEKIALATRFPKDYYESFNILRYQLGQKYDSHYDAF---HSAEYGPLISQRVVTFLLFLSSV 196

  Fly   420 PYGGATVFPRLN---------------VKVPAERGKVLFWYNL--NGDTHDMEPTTMHAACPVFH 467
            ..||.|:||..|               :||...:|..:|:|||  ||   .::.|::|.:|||..
plant   197 EEGGETMFPFENGRNMNGRYDYEKCVGLKVKPRQGDAIFFYNLFPNG---TIDQTSLHGSCPVIK 258

  Fly   468 GSKWVMTAWIHE--YD 481
            |.|||.|.||.:  ||
plant   259 GEKWVATKWIRDQTYD 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaNE3NP_651814.1 P4Ha_N 25..149 CDD:285528
P4Hc 316..478 CDD:214780 52/189 (28%)
P4H13NP_850038.1 TatC <4..>40 CDD:294353
P4Hc 85..269 CDD:214780 52/190 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.930

Return to query results.
Submit another query.