DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaNE3 and P4H5

DIOPT Version :9

Sequence 1:NP_651814.1 Gene:PH4alphaNE3 / 326114 FlyBaseID:FBgn0051017 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_179363.1 Gene:P4H5 / 816281 AraportID:AT2G17720 Length:291 Species:Arabidopsis thaliana


Alignment Length:212 Identity:64/212 - (30%)
Similarity:108/212 - (50%) Gaps:31/212 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 MEEISLEPHIVVYHDILPDKDIQQLITLAEPLLKPTEMFDDNKNEARSS-YRTPLG-------GP 354
            :|.||.||..||||:.|.:::.:.||:||:|.:..:.:.|:....::.| .||..|       ..
plant    80 VEVISWEPRAVVYHNFLTNEECEHLISLAKPSMVKSTVVDEKTGGSKDSRVRTSSGTFLRRGHDE 144

  Fly   355 LLDSLTQRMRDITGLQIRQGNPINIIKYGFGAPYTNYYDFFKKRNSESKGFGDRMATFMFYLNDA 419
            :::.:.:|:.|.|.:.:..|..:.::.|..|..|..:||:|....:...| |.|:||.:.||:|.
plant   145 VVEVIEKRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFNTKNG-GQRIATVLMYLSDV 208

  Fly   420 PYGGATVFP--RLNVK------------------VPAERGKVLFWYNLNGDTHDMEPTTMHAACP 464
            ..||.||||  |.|:.                  :|.:|..:||| |:..|. .::|:::|..||
plant   209 DDGGETVFPAARGNISAVPWWNELSKCGKEGLSVLPKKRDALLFW-NMRPDA-SLDPSSLHGGCP 271

  Fly   465 VFHGSKWVMTAWIHEYD 481
            |..|:||..|.|.|.::
plant   272 VVKGNKWSSTKWFHVHE 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaNE3NP_651814.1 P4Ha_N 25..149 CDD:285528
P4Hc 316..478 CDD:214780 53/189 (28%)
P4H5NP_179363.1 PLN00052 75..290 CDD:177683 64/212 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.930

Return to query results.
Submit another query.