DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaNE3 and p4htma

DIOPT Version :9

Sequence 1:NP_651814.1 Gene:PH4alphaNE3 / 326114 FlyBaseID:FBgn0051017 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_001074160.1 Gene:p4htma / 791209 ZFINID:ZDB-GENE-070112-2222 Length:478 Species:Danio rerio


Alignment Length:333 Identity:75/333 - (22%)
Similarity:118/333 - (35%) Gaps:82/333 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 VYEVLGMNRQDVALLQARCLVELDR-RDEAHEVLLDQPD-----LADNSISLLD--QFKANPYEA 253
            ::|:.|.    :::.::..:::|.: :...|..||..||     ..|...||||  |......|.
Zfish   142 LFEIPGF----LSVEESNVVMQLAQLKGLTHSSLLTNPDQEEQLTQDELFSLLDLNQDGLLQREE 202

  Fly   254 IDSSPKLGEGYKRLCRSSFSPNPSKLHCRYNSTTSAFLILAPLKMEEISLEPHIVVYHDILPDKD 318
            |.|.....:|   ...||:  |..|:|....:..|..|.|...|    .:...::.|.......|
Zfish   203 ILSLSHSTDG---SWLSSY--NLRKIHTGLETNPSGVLSLQEFK----RVSGGVLRYSGAAQGLD 258

  Fly   319 IQQLITLAEPLLKPTEMFDDNKNEARSSY-RTPLG---GPLLDSLTQRMRDITGLQ---IRQGNP 376
                              ...|...||:: |..||   ..||.|:..|:..:|.|.   :.....
Zfish   259 ------------------GHTKVRQRSTHTRLYLGEGTHHLLKSVRNRVTRLTRLPSSLVDLSEA 305

  Fly   377 INIIKYGFGAPYTNYYDFFKKR--NS---------ESKGFGDRMATFMFYLNDAPYGGATVFP-- 428
            :.:::|..|.....::|.....  ||         .|.....|..|.:.|||.|..||.|.||  
Zfish   306 MEVVRYEQGVFSHAHHDSSPTHPDNSCTHTHLAANTSNQVACRYLTVLLYLNSADSGGETSFPVA 370

  Fly   429 -------------------RLNVKVPAERGKVLFWYNL----NGDTHDMEPTTMHAACPVFHGSK 470
                               :.|:||....|..|.|||.    ||...:::..::|..|.|..|.|
Zfish   371 DNRTYEEEVLGDLSQQYCDKGNLKVKPVAGTALLWYNHLSDGNGWVGELDEFSLHGDCLVTRGFK 435

  Fly   471 WVMTAWIH 478
            |..:.|::
Zfish   436 WTGSVWVN 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaNE3NP_651814.1 P4Ha_N 25..149 CDD:285528
P4Hc 316..478 CDD:214780 47/204 (23%)
p4htmaNP_001074160.1 2OG-FeII_Oxy <272..442 CDD:304390 41/169 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583483
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.