DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaNE3 and P4htm

DIOPT Version :9

Sequence 1:NP_651814.1 Gene:PH4alphaNE3 / 326114 FlyBaseID:FBgn0051017 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_083220.3 Gene:P4htm / 74443 MGIID:1921693 Length:503 Species:Mus musculus


Alignment Length:392 Identity:84/392 - (21%)
Similarity:142/392 - (36%) Gaps:132/392 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 VRFNSTLPALDCFEVAKMYFKWGYFKQALQWITISKARMKEEYSGVYEVLGMNRQDVALLQARCL 216
            :|..|..|.|  ||:.      |:.......:.|..|:||          |:.|..:        
Mouse   136 IRTLSLKPLL--FEIP------GFLSDEECRLIIHLAQMK----------GLQRSQI-------- 174

  Fly   217 VELDRRDEAHEVL-LDQPDLADNSISLLDQFKANPYE--AIDSSPKLGEGYKRLCRSSFSPNPSK 278
            :..:..:||...: :.|.||    ..||||......:  .:.:..:||.|               
Mouse   175 LPTEEYEEAMSAMQVSQLDL----FQLLDQNHDGRLQLREVLAQTRLGNG--------------- 220

  Fly   279 LHCRYNSTTSAFLILAPLKMEEISLEPHIVVYHDILPDKDIQQLITLAEPLLKPTEMFDDNK--- 340
               |:         :.|..::|        :|..|..|.|...:::|.|  ....::.|.:|   
Mouse   221 ---RW---------MTPENIQE--------MYSAIKADPDGDGVLSLQE--FSNMDLRDFHKYMR 263

  Fly   341 ------NE-ARSSYRTPL-----GGPLLDSLTQRMRDITGLQ---IRQGNPINIIKYGFGAPYTN 390
                  || .|:|:.|.|     ...::.::.||:..:|.|.   :....|:.:::||.|..|..
Mouse   264 SHKAESNELVRNSHHTWLHQGEGAHHVMRAIRQRVLRLTRLSPEIVEFSEPLQVVRYGEGGHYHA 328

  Fly   391 YYD-----------FFKKRNSESKGF--GDRMATFMFYLNDAPYGGATVFP-------------- 428
            :.|           ..|...:||..|  ..|..|.:||||:...||.||||              
Mouse   329 HVDSGPVYPETICSHTKLVANESVPFETSCRYMTVLFYLNNVTGGGETVFPVADNRTYDEMSLIQ 393

  Fly   429 -------------RLNVKVPAERGKVLFWYNL----NGDTHDMEPTTMHAACPVFHGSKWVMTAW 476
                         :.|::|..::|..:||||.    .|...:::..::|..|.|..|:||:...|
Mouse   394 DDVDLRDTRRHCDKGNLRVKPQQGTAVFWYNYLPDGQGWVGEVDDYSLHGGCLVTRGTKWIANNW 458

  Fly   477 IH 478
            |:
Mouse   459 IN 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaNE3NP_651814.1 P4Ha_N 25..149 CDD:285528
P4Hc 316..478 CDD:214780 53/223 (24%)
P4htmNP_083220.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..110
EF-hand_7 193..253 CDD:290234 18/100 (18%)
EFh 195..253 CDD:298682 16/94 (17%)
P4Hc 247..459 CDD:214780 50/213 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839373
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.