DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaNE3 and Y43F8B.19

DIOPT Version :9

Sequence 1:NP_651814.1 Gene:PH4alphaNE3 / 326114 FlyBaseID:FBgn0051017 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_001123044.2 Gene:Y43F8B.19 / 6418801 WormBaseID:WBGene00077688 Length:243 Species:Caenorhabditis elegans


Alignment Length:200 Identity:53/200 - (26%)
Similarity:92/200 - (46%) Gaps:15/200 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 LKMEEISLEPHIVVYHDILPDKDIQQLITLAEPL-LKPTEMFDDNKNEARSSYRTPLG------- 352
            :|:|.::..|.:|:|.|:...|.::..:.|.|.| .:...:.:|:.|:..|..|...|       
 Worm    22 VKVEVVAWRPGLVIYRDLFTGKQVRDHLELMEHLKFEEQLVVNDDGNDIVSKIRRANGTQVFHED 86

  Fly   353 GPLLDSLTQRMRD-ITGLQIRQGNPINIIKYGFGAPYTNYYDFF-----KKRNSESKGFGDRMAT 411
            .|...|:....:: :..|..:....|..:.|..|..|..::|:.     |:.:...:..|:|..|
 Worm    87 HPAARSIWDTAKNLLPNLNFKTAEDILALSYNPGGHYAAHHDYLLYPSEKEWDEWMRVNGNRFGT 151

  Fly   412 FMFYLNDAPYGGATVFPRLNVKVPAERGKVLFWYNLNGDTHDMEPTTMHAACPVFHGSKWVMTAW 476
            .:.....|..|||||||||...|..:.|...||:|..|:: :.|..:.||.||::.|.|.:.|.|
 Worm   152 LIMAFGAAESGGATVFPRLGAAVRTKPGDAFFWFNAMGNS-EQEDLSEHAGCPIYKGQKQISTIW 215

  Fly   477 IHEYD 481
            :...|
 Worm   216 LRMRD 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaNE3NP_651814.1 P4Ha_N 25..149 CDD:285528
P4Hc 316..478 CDD:214780 46/175 (26%)
Y43F8B.19NP_001123044.2 P4Hc 43..217 CDD:214780 46/174 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.