DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaNE3 and p4ha3

DIOPT Version :9

Sequence 1:NP_651814.1 Gene:PH4alphaNE3 / 326114 FlyBaseID:FBgn0051017 Length:481 Species:Drosophila melanogaster
Sequence 2:XP_021322008.1 Gene:p4ha3 / 563281 ZFINID:ZDB-GENE-041010-4 Length:616 Species:Danio rerio


Alignment Length:505 Identity:126/505 - (24%)
Similarity:211/505 - (41%) Gaps:91/505 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ELIDNLMNYAEKIDEKASQLKRLAQELRQPLHSAKGRE-EEYLGNPLHSFPLIRHMYQDWRYLEE 96
            :|||:|:.|.|...::...:||....:.. ||.....| .:.:.||:.:|.|::.:..:|.   .
Zfish    40 KLIDHLIIYIEHEAQRLEDIKRFFSRVTS-LHDGIYNEPSDPIANPIAAFKLVKRLKSEWL---N 100

  Fly    97 FMKKPVGEEEIQFL----RRKLPELPWQVDTEEASVSIFRIAETYGMMPWDMANG----LIDNVR 153
            .:.....||.|:.|    ||....||...|...|:..:.|:.:.|.:....:..|    :.|.|.
Zfish   101 VVHSTEAEENIKVLREDYRRMESSLPKLEDLRGAAHGLMRLQDVYNLHVESLVRGHFQQISDPVD 165

  Fly   154 F-----NSTLPALDCFEVAKMYFKWGYFKQALQWITISKARMKEEYSGVYEVLGMNRQDVALLQA 213
            |     :..|...|||.|.|:.:....:..::.|.        ||...::.....:.::...|: 
Zfish   166 FYKLSVSDMLSGDDCFLVGKVAYDLEDYYHSVLWF--------EEAVRLFRGTEWSPENEGTLE- 221

  Fly   214 RCLVELDRRDE-----------AHEVLLDQPDLADNSISLLDQFKANPYEAI--DSSPKLGEG-- 263
                  |..|.           :|.:.|.:..|..:.::....|....||.:  ::.|....|  
Zfish   222 ------DALDHLAFSHFKTGNISHALSLSRELLLHDPMNRRVHFNVEKYEKLLNENLPATSSGLT 280

  Fly   264 --------------YKRLCRSSFS-----PNPSKLHCRYNSTTSAFLILAPLKMEEISLEPHIVV 309
                          |::||::..|     .||| |.|.|.:..|..|.|.|::.|.|||:|::|:
Zfish   281 LKRPDGIYLRTRNAYEQLCQTKGSQPKHFENPS-LFCDYFTNGSPALFLQPIRREIISLQPYVVL 344

  Fly   310 YHDILPDKDIQQLITLAEPLLKPTEMFDDNKNEARSSYRTPLGGPLLDS-------LTQRMRDIT 367
            :|..:...:.:.:...|.|.|: ..:.....|:|.:.||......|.:|       |.||:..:|
Zfish   345 FHGFVTQAEAKNIRKYAMPGLR-RSVVASGMNQATAEYRISKSAWLKESAHEVVGKLDQRITLVT 408

  Fly   368 GLQIR--QGNPINIIKYGFGAPYTNYYDFFKKRNSESKGF-----GDRMATFMFYLNDAPYGGAT 425
            ||.::  ....:.::.||.|..|..::|   ...|:|...     |:|:||.|.||:....||:|
Zfish   409 GLNVQPPYAEYLQVVNYGIGGHYEPHFD---HATSDSSPLYRLKTGNRVATIMIYLSPVQAGGST 470

  Fly   426 VFPRLNVKVPAERGKVLFWYNL--NGDTHDMEPTTMHAACPVFHGSKWVM 473
            .|...|..||..:...|||:||  ||..:   ..|:||.|||..|:||.|
Zfish   471 AFIYANFSVPVVQNAALFWWNLHKNGQGN---VDTLHAGCPVIVGNKWGM 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaNE3NP_651814.1 P4Ha_N 25..149 CDD:285528 29/124 (23%)
P4Hc 316..478 CDD:214780 53/174 (30%)
p4ha3XP_021322008.1 P4Ha_N 27..157 CDD:311993 29/120 (24%)
P4Hc 350..519 CDD:214780 53/175 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583401
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.