DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaNE3 and P4HTM

DIOPT Version :9

Sequence 1:NP_651814.1 Gene:PH4alphaNE3 / 326114 FlyBaseID:FBgn0051017 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_808807.2 Gene:P4HTM / 54681 HGNCID:28858 Length:563 Species:Homo sapiens


Alignment Length:464 Identity:83/464 - (17%)
Similarity:139/464 - (29%) Gaps:215/464 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 VRFNSTLPALDCFEVAKMYFKWGYFKQALQWITISKARMK----------EEYSGVYEVLGMNRQ 206
            :|..|..|.|  ||:.      |:.......:.|..|:||          |||......:.:::.
Human   135 IRTLSLKPLL--FEIP------GFLTDEECRLIIHLAQMKGLQRSQILPTEEYEEAMSTMQVSQL 191

  Fly   207 DVALLQARCLVELDRRDEAH----EVLLDQPDLADNSISLLDQFKANPYEAIDSSPKLGEGYKRL 267
            |:..|       ||:..:.|    |||                          :..:||.|:   
Human   192 DLFRL-------LDQNRDGHLQLREVL--------------------------AQTRLGNGW--- 220

  Fly   268 CRSSFSPNPSKLHCRYNSTTSAFLILAPLKMEEISLEPHIVVYHDILPDKDIQQLITLAEPLLKP 332
                                    .:.|..::|        :|..|..|.|...:::|.|  ...
Human   221 ------------------------WMTPESIQE--------MYAAIKADPDGDGVLSLQE--FSN 251

  Fly   333 TEMFDDNK----NEARSS-----------YRTPLGGPLLDSLTQRMRDITGLQ---IRQGNPINI 379
            .::.|.:|    ::|.||           |:......::.::.||:..:|.|.   :....|:.:
Human   252 MDLRDFHKYMRSHKAESSELVRNSHHTWLYQGEGAHHIMRAIRQRVLRLTRLSPEIVELSEPLQV 316

  Fly   380 IKYGFGAPYTNYYD-----------FFKKRNSESKGF---------------------------- 405
            ::||.|..|..:.|           ..|...:||..|                            
Human   317 VRYGEGGHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRQVSPNWGLPSILRPGTPMTQAQP 381

  Fly   406 -----------GDRMA------------------------TFMFYLNDAPYGGATVFP------- 428
                       ||...                        |.:||||:...||.||||       
Human   382 CTVGVPLGMGPGDHWVIPVSPWEHPQLGTCSVPPLPYSYMTVLFYLNNVTGGGETVFPVADNRTY 446

  Fly   429 --------------------RLNVKVPAERGKVLFWYNL----NGDTHDMEPTTMHAACPVFHGS 469
                                :.|::|..::|..:||||.    .|...|::..::|..|.|..|:
Human   447 DEMSLIQDDVDLRDTRRHCDKGNLRVKPQQGTAVFWYNYLPDGQGWVGDVDDYSLHGGCLVTRGT 511

  Fly   470 KWVMTAWIH 478
            ||:...||:
Human   512 KWIANNWIN 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaNE3NP_651814.1 P4Ha_N 25..149 CDD:285528
P4Hc 316..478 CDD:214780 53/284 (19%)
P4HTMNP_808807.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..111
EF-hand_7 192..252 CDD:290234 19/129 (15%)
EFh 194..252 CDD:238008 18/127 (14%)
P4Hc 246..519 CDD:214780 50/274 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149315
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.