DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaNE3 and CG31021

DIOPT Version :9

Sequence 1:NP_651814.1 Gene:PH4alphaNE3 / 326114 FlyBaseID:FBgn0051017 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_733392.2 Gene:CG31021 / 43638 FlyBaseID:FBgn0051021 Length:453 Species:Drosophila melanogaster


Alignment Length:491 Identity:129/491 - (26%)
Similarity:226/491 - (46%) Gaps:75/491 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LMQLDVELIDNLMNYAEKIDEKASQLKRLAQELRQPLHSAKGREEEYLGNPLHSFPLIRHMYQDW 91
            ::.|:..|:.|:.:||||::||...:....::....:..|....|:||.|||:||.|||||:|||
  Fly     1 MLNLERNLLQNMRDYAEKLEEKIDLINNYVEDYNVDIEDANEDPEKYLSNPLNSFRLIRHMHQDW 65

  Fly    92 RYLEEFMKKPVGEEEIQFLRRKLPELPWQVDTEEASVSIFRIAETYGMMPWDMANGLIDNVRFNS 156
            ...:.:|:..|..|.:|.:...||:||.:....:|:.|:..:.:.||..|.|:   :..:.|.:|
  Fly    66 VGWQVYMEDLVAPEAVQKVESLLPQLPQKEAFRKAARSVHSLTQFYGYEPADL---VAKDERSSS 127

  Fly   157 T-LPALDCFEVAKMYFKWGYFKQALQWI-------TISKARMKEEYSGVYEVLGMNRQDVALLQA 213
            . |..|||:.:....::...:..|.:|:       |:|:.|      .::..||..|..|.....
  Fly   128 LHLSPLDCYHLGLELYEEQDYLGAAKWLQVAAHNYTLSRHR------DLFNPLGAPRWQVYRDLG 186

  Fly   214 RCLVELDRR--DEAHEVLLDQPDLADNSISLLDQ------FK-ANPYEAI-DSSPK--LGEGYKR 266
            |.|::|:|:  .:|:|..|   .|...::.|:.:      |. .:|.|.| |..||  :.|.|  
  Fly   187 RTLLKLNRQCAYDAYESAL---RLNSQNVHLMKEAGQMELFSLRDPMEPILDLQPKPTVLEKY-- 246

  Fly   267 LCRSSFSPNPSKLHCRYNSTTSAFLILAPLKMEEISLEPHIVVYHDILPDKDIQQLITLAEPLLK 331
             ||.....:..:|.|..|....:||..||:|.|::..:|.|::|...:.:::|:. :..|.....
  Fly   247 -CRGEVPRHQGRLTCELNDWVHSFLAYAPIKFEDLQQDPFIILYPGSIYEQEIRH-VENAYERCP 309

  Fly   332 PTEMFDDNKNEARSSYRTPLG----------GPLLDSLTQRMRDITGLQIRQGNPINIIKYGFGA 386
            |.:.|:           ..||          .|:|..:.:|:.|:.|:: :..:...|::|...|
  Fly   310 PNDRFE-----------LKLGISGCSISDGYSPVLKRINERILDMAGVE-KTWDTFYIVEYAQLA 362

  Fly   387 PYTNYYDFFKKRNSES------KGFGDRMATFMFYLNDAPYGGATVFPRLNVKVPAERGKVLFWY 445
            |:..:..|   |||..      ..|.|..|..:.:|.|...|||...|..::.|..:||.||..:
  Fly   363 PFEPFKLF---RNSTKFPKLNLMNFEDVEAKVIIFLKDVTLGGAFTMPNGDILVQPKRGNVLITF 424

  Fly   446 NLNGDTHDMEPTTMHAACPVFHGSKWVMTAWIHEYD 481
            .     ::...||:   ||:..|:..||..:|.:.|
  Fly   425 E-----NEEHSTTI---CPIIEGTGLVMIKFIMKTD 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaNE3NP_651814.1 P4Ha_N 25..149 CDD:285528 40/121 (33%)
P4Hc 316..478 CDD:214780 40/177 (23%)
CG31021NP_733392.2 P4Ha_N 1..119 CDD:285528 40/120 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452364
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.