DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaNE3 and CG31371

DIOPT Version :9

Sequence 1:NP_651814.1 Gene:PH4alphaNE3 / 326114 FlyBaseID:FBgn0051017 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_733375.2 Gene:CG31371 / 43626 FlyBaseID:FBgn0051371 Length:507 Species:Drosophila melanogaster


Alignment Length:520 Identity:125/520 - (24%)
Similarity:218/520 - (41%) Gaps:109/520 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFCKVEST--LNW----ESRQEFLDTESAKMDLMQLDVELIDNLMNYAEKIDEKASQLKRLAQEL 59
            :|..|||.  .|:    |..|..||||:          :|||.|.:|.|:::.:..:::|....:
  Fly    13 LFLLVESVAGANFARGEEQLQALLDTET----------QLIDGLRDYIERLERQLEEIRRETSAI 67

  Fly    60 RQPLHSAKGREEEYLGNPLHSFPLIRHMYQDWRYLEE----FMKKPVGEEEIQFLRRKLPELPWQ 120
            .: :||.....|||:||||:.|.:::.....|..||:    .::...||.    |..:...||.:
  Fly    68 EE-IHSQVDSVEEYMGNPLNVFGILKRFESVWPGLEQKANATLEMVFGER----LSDRQLTLPSE 127

  Fly   121 VDTEEASVSIFRIAETYGMMPWDMANGLIDNVRFNSTLPALDCFEVAKMYFKWGYFKQALQWITI 185
            .|.||:...:..:...|.:....::.|:::..:..|::...||.|||:.    ..|..|..|:..
  Fly   128 EDYEESLNHLLHLQSVYELDSNSLSLGVVNGFKLGSSMSWGDCLEVARK----SDFPVARFWLES 188

  Fly   186 SKARM-----------KEEYSGVYEVLGMNRQDVALLQARCLVELDRRDE-------AHEVLLDQ 232
            :..::           :|..||          .|.:|:|...:|. |..|       |.|:||..
  Fly   189 ALEKLPSASENSTESQRERESG----------RVHILEATLNIEY-RAGELSRALATAEELLLLL 242

  Fly   233 PDLADNSISLLDQFKANPYEAIDSSPKLGEGYKRLCRSSFSPNPSKL------------------ 279
            |  .:..|....: |.....|....|| |.|.|...:...|.:..:|                  
  Fly   243 P--MNQGIQKAKR-KIEKAMAKKELPK-GRGQKSKAKKQISKSTEQLLIEEICRGAKQQVTTGSR 303

  Fly   280 --HCRYNSTTSAFLILAPLKMEEISLEPHIVVYHDILPDKDIQQLITLAEPLLKPTEMFDDNKNE 342
              ||:.:. :|.:|:|.|.::|.:|.:|:||::||:|..|:..:|:          ::.|:.::.
  Fly   304 FNHCQLDG-SSPWLLLQPSRLEPVSSDPYIVLHHDVLTPKESNELL----------QLIDEEEDT 357

  Fly   343 ARSSYRTPLGGPLLDSLTQRMRDITGLQIRQGNPINIIKYGFGAPYTNYYDFFKK--RNSESKGF 405
            ...||::.....|......|:..:.||:|.:.:|....::|        ::...|  .:||.|  
  Fly   358 KGVSYQSLKLSKLAQKKLGRISRLLGLEILELDPWTGRRHG--------HEHITKLEHSSELK-- 412

  Fly   406 GDRMATFMFYLNDAPYGGATVFPRLNVKVPAERGKVLFWYN--LNGDTHDMEPTTMHAACPVFHG 468
              .:|..|..|.....|||.|||:|.:.|...||.:|.|..  ..|.:.:.:..:..|.|||..|
  Fly   413 --HVARLMLNLQAPGMGGAVVFPQLELAVNVPRGSLLHWRTRFAGGSSSEWDYRSGQAICPVLLG 475

  Fly   469  468
              Fly   476  475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaNE3NP_651814.1 P4Ha_N 25..149 CDD:285528 30/127 (24%)
P4Hc 316..478 CDD:214780 37/157 (24%)
CG31371NP_733375.2 P4Ha_N 30..156 CDD:285528 36/140 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461801
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X129
65.840

Return to query results.
Submit another query.