DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaNE3 and CG34041

DIOPT Version :9

Sequence 1:NP_651814.1 Gene:PH4alphaNE3 / 326114 FlyBaseID:FBgn0051017 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster


Alignment Length:348 Identity:71/348 - (20%)
Similarity:139/348 - (39%) Gaps:76/348 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NWESRQEFLDTESAKMDLMQLDVELIDNLMNYAEKIDEKASQLKRLAQELRQPLHSAKGREE-EY 73
            |.|:|...  ::|..::::::...::..|.||...::.|...:.....:| ...|....|:: ..
  Fly   252 NSENRHSL--SKSKVINILKIQENVVKYLENYIYALETKLKTIDEALIDL-ATYHIQFERDKLAI 313

  Fly    74 LGNPLHSFPLIRHMYQDWRYLEEFMKKPVGEEEIQFLRRKLPELPWQVDTEEASVSIFRIAETYG 138
            ..:|:.|:.||.||..||.:.:.|:::..|::|:..|......||.:.|..|....|.::...|.
  Fly   314 ASSPVASYSLIHHMQSDWTHWQLFLQEDPGKDELASLMSIKKYLPTKNDISEVCHGISKMLNAYL 378

  Fly   139 MMPWDMANGLIDNVRFNSTLPAL-------------------DCFEVAKMYFKWGYFKQALQWIT 184
            |...|:|||:|...:......||                   ||..::....:...:.::.:|:.
  Fly   379 MTAQDIANGVILGTQTKYISSALKLEYLYMEIICNRHLMSLRDCVALSDHSMEMKDYNKSKEWLN 443

  Fly   185 ISKARMKEE------------YSGVYEV--------LGMNRQDVALL---QARCLVELDRRDEAH 226
            ::.:.::..            |..:.||        |.:...:.||.   :...|:.:.:|...|
  Fly   444 VAISMLESSAYWDPIVPSADLYLKLAEVYVKQQNWTLALETVEFALKSNPRNAQLIRMQKRLSYH 508

  Fly   227 EVLLDQPDLADNSISLLDQFKANPYEAIDSSPKLG-EGYKRLCRSSFSPNPSKLHCRYNSTTSAF 290
             :||..|                      .||||. |......|.:.|     |:|.|::....|
  Fly   509 -ILLGPP----------------------KSPKLNIENNDYRLRKNGS-----LYCFYDTKIRTF 545

  Fly   291 L-ILAPLKMEEISLEPHIVVYHD 312
            . :|||:|.|.:.::|.:::||:
  Fly   546 YSLLAPIKAEVLFIDPLVILYHE 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaNE3NP_651814.1 P4Ha_N 25..149 CDD:285528 30/124 (24%)
P4Hc 316..478 CDD:214780
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 31/129 (24%)
TPR repeat 452..491 CDD:276809 6/38 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462003
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.