DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaNE3 and P4ha3

DIOPT Version :9

Sequence 1:NP_651814.1 Gene:PH4alphaNE3 / 326114 FlyBaseID:FBgn0051017 Length:481 Species:Drosophila melanogaster
Sequence 2:XP_038938408.1 Gene:P4ha3 / 361612 RGDID:735150 Length:549 Species:Rattus norvegicus


Alignment Length:520 Identity:128/520 - (24%)
Similarity:223/520 - (42%) Gaps:112/520 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DTESAKMDLMQL---DVELIDNLMNYAEKIDEKASQLKR-------LAQELRQPLHSAKGREEEY 73
            ||.||...:.:.   :..|:..|..|....:.:...|.|       |.::|:.|           
  Rat    29 DTFSALTSVARALAPERRLLGTLRRYLRGEEARLRDLTRFYDKVLSLHEDLKIP----------- 82

  Fly    74 LGNPLHSFPLIRHMYQDWRYLEEFMKKPVGEEEIQFLR----RKLPELPWQVDTEEASVSIFRIA 134
            :.|||.:|.||:.:..|||.:...::   ..|.|:.|:    :...:||...|.|.|:.::.|:.
  Rat    83 VVNPLLAFTLIKRLQSDWRNVVHSLE---ATENIRALKDGYEKVEQDLPAFEDLEGAARALMRLQ 144

  Fly   135 ETYGMMPWDMANGLIDNVRFNS-----------TLPALDCFEVAKMYFKWGYFKQALQWITISKA 188
            :.|.:....:|.|:...|..:|           :|.|.|||:|.|:.:..|.:..|:.|:..:.:
  Rat   145 DVYMLNVKGLAQGVFQRVTGSSITDLYSPRQLFSLTADDCFQVGKVAYDTGDYYHAIPWLEEAVS 209

  Fly   189 RMKEEYSGVYEVLGMNRQDVALLQ---------------ARCLVELDRRDEAHEVLLDQPD---L 235
            ..:..| |.::.     :|.|.|:               ..|.:.|.|     |.|:..||   :
  Rat   210 LFRRSY-GEWKT-----EDEASLEDALDYLAFACYQVGNVSCALSLSR-----EFLVYSPDNKRM 263

  Fly   236 ADNSISLLDQFKANPY----EAIDSSPKL-----GEGYKRLCRSSFS-PN----PSKLHCRYNST 286
            |.|.:........|.:    |.....|.:     .:.|:.||::..| |.    || |:|.|.:.
  Rat   264 ARNVLKYERLLAENGHLMAAETAIQRPNVPHLQTRDTYEGLCQTLGSQPTHYQIPS-LYCSYETN 327

  Fly   287 TSAFLILAPLKMEEISLEPHIVVYHDILPDKDIQQLITLAEPLLKPTEMFDDNK------NEARS 345
            :|.:|:|.|.:.|.|.|.|.:.:|||.:.|::.|::..||||.|:.:.:....|      ..::|
  Rat   328 SSPYLLLQPARKEVIHLRPLVALYHDFVSDEEAQKIRELAEPWLQRSVVASGEKQLQVEYRISKS 392

  Fly   346 SYRTPLGGPLLDSLTQRMRDITGLQIR--QGNPINIIKYGFGAPYTNYYD--------FFKKRNS 400
            ::......|:|.:|.:|:..:|||.|:  ....:.::.||.|..|..::|        .:|.:: 
  Rat   393 AWLKDTVDPVLVTLDRRIAALTGLDIQPPYAEYLQVVNYGIGGHYEPHFDHATSPSSPLYKMKS- 456

  Fly   401 ESKGFGDRMATFMFYLNDAPYGGATVFPRLNVKVPAERGKVLFWYNLNGDTHDMEPTTMHAACPV 465
                 |:|:||.|.||:....||||.|...|..||     |:.| ..:|.| .|:..:...|.|:
  Rat   457 -----GNRVATLMIYLSSVEAGGATAFIYGNFSVP-----VVKW-PTSGYT-SMDRNSEDPAAPI 509

  Fly   466  465
              Rat   510  509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaNE3NP_651814.1 P4Ha_N 25..149 CDD:285528 29/137 (21%)
P4Hc 316..478 CDD:214780 45/166 (27%)
P4ha3XP_038938408.1 P4Ha_N 34..108 CDD:400573 17/84 (20%)
P4Hc 356..>478 CDD:214780 34/127 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343162
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.