DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaNE3 and P4htm

DIOPT Version :9

Sequence 1:NP_651814.1 Gene:PH4alphaNE3 / 326114 FlyBaseID:FBgn0051017 Length:481 Species:Drosophila melanogaster
Sequence 2:XP_217285.7 Gene:P4htm / 301008 RGDID:1311848 Length:503 Species:Rattus norvegicus


Alignment Length:392 Identity:83/392 - (21%)
Similarity:142/392 - (36%) Gaps:132/392 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 VRFNSTLPALDCFEVAKMYFKWGYFKQALQWITISKARMKEEYSGVYEVLGMNRQDVALLQARCL 216
            :|..|..|.|  ||:.      |:.......:.|..|:||          |:.|..:        
  Rat   136 IRTLSLKPLL--FEIP------GFLSDEECRLIIHLAQMK----------GLQRSQI-------- 174

  Fly   217 VELDRRDEAHEVL-LDQPDLADNSISLLDQFKANPYE--AIDSSPKLGEGYKRLCRSSFSPNPSK 278
            :..:..:||...: :.|.||    ..||||......:  .:.:..:||.|               
  Rat   175 LPTEEYEEAMSAMRVSQLDL----FQLLDQNHDGRLQLREVLAQTRLGNG--------------- 220

  Fly   279 LHCRYNSTTSAFLILAPLKMEEISLEPHIVVYHDILPDKDIQQLITLAEPLLKPTEMFD------ 337
               |:         :.|..::|        :|..|..|.|...:::|.|  ....::.|      
  Rat   221 ---RW---------MTPENIQE--------MYSAIKADPDGDGVLSLQE--FSNMDLRDFHKYMR 263

  Fly   338 DNKNEA----RSSYRTPL-----GGPLLDSLTQRMRDITGLQ---IRQGNPINIIKYGFGAPYTN 390
            .:|.|:    |:|:.|.|     ...::.::.||:..:|.|.   :....|:.:::||.|..|..
  Rat   264 SHKAESSELVRNSHHTWLHQGEGAHHVMRAIRQRVLRLTRLSPEIVELSEPLQVVRYGEGGHYHA 328

  Fly   391 YYD-----------FFKKRNSESKGF--GDRMATFMFYLNDAPYGGATVFP-------------- 428
            :.|           ..|...:||..|  ..|..|.:||||:...||.||||              
  Rat   329 HVDSGPVYPETVCSHTKLVANESVPFETSCRYMTVLFYLNNVTGGGETVFPVADNRTYDEMSLIQ 393

  Fly   429 -------------RLNVKVPAERGKVLFWYNL----NGDTHDMEPTTMHAACPVFHGSKWVMTAW 476
                         :.|::|..::|..:||||.    .|...:::..::|..|.|..|:||:...|
  Rat   394 DNVDLRDTRRHCDKGNLRVKPQQGTAVFWYNYLPDGQGWVGEVDDYSLHGGCLVTRGTKWIANNW 458

  Fly   477 IH 478
            |:
  Rat   459 IN 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaNE3NP_651814.1 P4Ha_N 25..149 CDD:285528
P4Hc 316..478 CDD:214780 52/223 (23%)
P4htmXP_217285.7 EF-hand_7 193..253 CDD:404394 18/100 (18%)
P4Hc 247..459 CDD:214780 49/213 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343190
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.