DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaNE3 and P4HA3

DIOPT Version :9

Sequence 1:NP_651814.1 Gene:PH4alphaNE3 / 326114 FlyBaseID:FBgn0051017 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_001275677.1 Gene:P4HA3 / 283208 HGNCID:30135 Length:604 Species:Homo sapiens


Alignment Length:527 Identity:129/527 - (24%)
Similarity:219/527 - (41%) Gaps:124/527 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 KRLAQELRQPLHSAKGREEEY-----------------LGNPLHSFPLIRHMYQDWRYLEEFMKK 100
            :||...||:.|...:.|..:.                 :.|||.:|.||:.:..|||.:...:: 
Human    45 RRLLGLLRRYLRGEEARLRDLTRFYDKVLSLHEDSTTPVANPLLAFTLIKRLQSDWRNVVHSLE- 108

  Fly   101 PVGEEEIQFLR----RKLPELPWQVDTEEASVSIFRIAETYGMMPWDMANGLIDNVRFNS----- 156
              ..|.|:.|:    :...:||...|.|.|:.::.|:.:.|.:....:|.|:...|..::     
Human   109 --ASENIRALKDGYEKVEQDLPAFEDLEGAARALMRLQDVYMLNVKGLARGVFQRVTGSAITDLY 171

  Fly   157 ------TLPALDCFEVAKMYFKWGYFKQALQWITISKARMKEEYSGVYEVLGMNRQDVALLQ--- 212
                  :|...|||:|.|:.:..|.:..|:.|:..:.:..:..| |.::.     :|.|.|:   
Human   172 SPKRLFSLTGDDCFQVGKVAYDMGDYYHAIPWLEEAVSLFRGSY-GEWKT-----EDEASLEDAL 230

  Fly   213 ------------ARCLVELDRRDEAHEVLLDQPD---LADNSISLLDQFKANP----YEAIDSSP 258
                        ..|.:.|.|     |.||..||   :|.|.:........:|    .||:...|
Human   231 DHLAFAYFRAGNVSCALSLSR-----EFLLYSPDNKRMARNVLKYERLLAESPNHVVAEAVIQRP 290

  Fly   259 KL-----GEGYKRLCRSSFS-PN----PSKLHCRYNSTTSAFLILAPLKMEEISLEPHIVVYHDI 313
            .:     .:.|:.||::..| |.    || |:|.|.:.::|:|:|.|::.|.|.|||:|.:|||.
Human   291 NIPHLQTRDTYEGLCQTLGSQPTLYQIPS-LYCSYETNSNAYLLLQPIRKEVIHLEPYIALYHDF 354

  Fly   314 LPDKDIQQLITLAEPLLKPTEMFDDNK------NEARSSYRTPLGGPLLDSLTQRMRDITGLQIR 372
            :.|.:.|::..||||.|:.:.:....|      ..::|::......|.|.:|..|:..:|||.:|
Human   355 VSDSEAQKIRELAEPWLQRSVVASGEKQLQVEYRISKSAWLKDTVDPKLVTLNHRIAALTGLDVR 419

  Fly   373 --QGNPINIIKYGFGAPYTNYYDFFKKRNS---ESKGFGDRMATFMFYLNDAPYGGATVFPRLNV 432
              ....:.::.||.|..|..::|.....:|   ..|. |:|:||||.||:....||||.|...|:
Human   420 PPYAEYLQVVNYGIGGHYEPHFDHATSPSSPLYRMKS-GNRVATFMIYLSSVEAGGATAFIYANL 483

  Fly   433 KVPAERG-------------------KVLFWYNLNG---------DTHDMEPTTMHAACPVFHGS 469
            .||..|.                   .||.|:.::|         |.:..:|     |.|.....
Human   484 SVPVVRHCFGGTCTGVVKGTVTHFMLAVLSWWEISGWPTSGYMSMDRNSADP-----AAPALKTE 543

  Fly   470 KWVMTAW 476
            .....:|
Human   544 LLAERSW 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaNE3NP_651814.1 P4Ha_N 25..149 CDD:285528 27/116 (23%)
P4Hc 316..478 CDD:214780 50/200 (25%)
P4HA3NP_001275677.1 P4Ha_N 58..159 CDD:285528 22/103 (21%)
TPR_12 186..252 CDD:290160 13/76 (17%)
P4Hc 356..>478 CDD:214780 36/122 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149287
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.