DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaNE3 and C14E2.4

DIOPT Version :9

Sequence 1:NP_651814.1 Gene:PH4alphaNE3 / 326114 FlyBaseID:FBgn0051017 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_001359861.1 Gene:C14E2.4 / 182616 WormBaseID:WBGene00015773 Length:311 Species:Caenorhabditis elegans


Alignment Length:203 Identity:57/203 - (28%)
Similarity:94/203 - (46%) Gaps:21/203 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 LKMEEISLEPHIVVYHDILPDKDIQQLITLAEPL-LKPTEMFDDNKNEARSSYR------TPL-- 351
            ::||.:|..|.:|:|.|:...|.:...:.|.:.| :...::..|:...|.|:||      ||.  
 Worm    81 VRMEILSWSPPLVIYRDVFSKKQVSDYLELLKNLKMNEQKVVRDDGEIAYSTYRQANGTITPAHS 145

  Fly   352 ---GGPLLDSLTQRMRDITGLQIRQGNPINIIKYGFGAPYTNYYDFFKKRNSESKG-----FGDR 408
               ...|:|:.|| :..:...|..:  .|:.:.|..|..|..:.||....|:|...     .|:|
 Worm   146 HAEAQSLMDTATQ-LLPVFDFQYTE--QISALSYIKGGHYALHTDFLTFANAEDSNRHFGEMGNR 207

  Fly   409 MATFMFYLNDAPYGGATVFPRLNVKVPAERGKVLFWYNLNGDTHDMEPTTMHAACPVFHGSKWVM 473
            :|||:.....|..||.|:||:|.....|..|....|:|.||:. :.|..::|..||:..|.|.:.
 Worm   208 LATFIMVFKKAEKGGGTLFPQLGNVFRANPGDAFLWFNCNGNL-EREAKSLHGGCPIRAGEKIIA 271

  Fly   474 TAWIHEYD 481
            |.||..::
 Worm   272 TIWIRIFN 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaNE3NP_651814.1 P4Ha_N 25..149 CDD:285528
P4Hc 316..478 CDD:214780 49/178 (28%)
C14E2.4NP_001359861.1 P4Hc 100..276 CDD:214780 49/179 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.