DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31016 and AT1G20270

DIOPT Version :9

Sequence 1:NP_001263119.1 Gene:CG31016 / 326113 FlyBaseID:FBgn0051016 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_564109.1 Gene:AT1G20270 / 838615 AraportID:AT1G20270 Length:287 Species:Arabidopsis thaliana


Alignment Length:213 Identity:71/213 - (33%)
Similarity:103/213 - (48%) Gaps:28/213 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 EELSLDPYVIFYHNVLSDAEIEKLKPMGKPFLERAKVFRVEKGSDEIDPSRSADGAWLPHQNIDP 381
            |.||.:|....|||.||..|.|.|..:.||.:.::.|...|.|..:....|::.|.:| .:..| 
plant    77 EVLSWEPRAFVYHNFLSKEECEYLISLAKPHMVKSTVVDSETGKSKDSRVRTSSGTFL-RRGRD- 139

  Fly   382 DDLEVLNRIGRRIEDMTGLNTRSGSKMQFLKYGFGGHFVPHYDYFNSKTFSLETVGDRIATVLFY 446
               :::..|.:||.|.|.:....|..:|.|.|..|..:.||||||..: |:.:..|.|:||:|.|
plant   140 ---KIIKTIEKRIADYTFIPADHGEGLQVLHYEAGQKYEPHYDYFVDE-FNTKNGGQRMATMLMY 200

  Fly   447 LNNVDHGGATVFPKLN-------------------LAVPTQKGSA-LFWHNIDRKSYDYDTRTFH 491
            |::|:.||.||||..|                   |:|..:.|.| |||..  |.....|..:.|
plant   201 LSDVEEGGETVFPAANMNFSSVPWYNELSECGKKGLSVKPRMGDALLFWSM--RPDATLDPTSLH 263

  Fly   492 GACPLISGTKLVMTRWIY 509
            |.||:|.|.|...|:|::
plant   264 GGCPVIRGNKWSSTKWMH 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31016NP_001263119.1 P4Ha_N 31..160 CDD:285528
P4Hc 333..508 CDD:214780 62/194 (32%)
AT1G20270NP_564109.1 CASIMO1 <3..38 CDD:420385
PLN00052 79..286 CDD:177683 70/211 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.