DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31016 and AT5G66060

DIOPT Version :9

Sequence 1:NP_001263119.1 Gene:CG31016 / 326113 FlyBaseID:FBgn0051016 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_201407.4 Gene:AT5G66060 / 836738 AraportID:AT5G66060 Length:289 Species:Arabidopsis thaliana


Alignment Length:265 Identity:74/265 - (27%)
Similarity:115/265 - (43%) Gaps:46/265 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 PSINLESWESDESFNQLCRSSSRRQMGESKPSRLHCRYNTITTPFLKLAPFRMEELSLDPYVIFY 328
            ||.|..|.::::..:.:.::..|....:||..|.                  :|.:|.:|....|
plant    44 PSNNAGSSKANDLTSIVRKTLQRSGEDDSKNERW------------------VEIISWEPRASVY 90

  Fly   329 HNVLSDAEIEKLKPMGKPFLERAKVFRVEKGSDEIDPSRSADGAWLPHQNIDPDDLEVLNRIGRR 393
            ||.|:..|.:.|..:.||.:|::.|...:.|.......|::.|.:|.....     :.:..|.:|
plant    91 HNFLTKEECKYLIELAKPHMEKSTVVDEKTGKSTDSRVRTSSGTFLARGRD-----KTIREIEKR 150

  Fly   394 IEDMTGLNTRSGSKMQFLKYGFGGHFVPHYDYFNSKTFSLETVGDRIATVLFYLNNVDHGGATVF 458
            |.|.|.:....|..:|.|.|..|..:.||||||..: ::....|.||||||.||::|:.||.|||
plant   151 ISDFTFIPVEHGEGLQVLHYEIGQKYEPHYDYFMDE-YNTRNGGQRIATVLMYLSDVEEGGETVF 214

  Fly   459 P-------------------KLNLAVPTQKGSA-LFWHNIDRKSYDYDTRTFHGACPLISGTKLV 503
            |                   |..|:|..:.|.| |||......:  .|..:.||.|.:|.|.|..
plant   215 PAAKGNYSAVPWWNELSECGKGGLSVKPKMGDALLFWSMTPDAT--LDPSSLHGGCAVIKGNKWS 277

  Fly   504 MTRWI 508
            .|:|:
plant   278 STKWL 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31016NP_001263119.1 P4Ha_N 31..160 CDD:285528
P4Hc 333..508 CDD:214780 58/194 (30%)
AT5G66060NP_201407.4 PLN00052 74..288 CDD:177683 67/235 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.