DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31016 and AT4G35820

DIOPT Version :9

Sequence 1:NP_001263119.1 Gene:CG31016 / 326113 FlyBaseID:FBgn0051016 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_195307.1 Gene:AT4G35820 / 829736 AraportID:AT4G35820 Length:272 Species:Arabidopsis thaliana


Alignment Length:288 Identity:77/288 - (26%)
Similarity:124/288 - (43%) Gaps:77/288 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 SALTVHFLRNKPKPSINLESWESDE------SFNQLCRSSSRRQMGE-----------SKPSRLH 298
            |..|:.:||.:.:   .|:.:|:.:      :|::|        :||           :|...|.
plant     6 SVSTILYLRQRLQ---GLKIYETSDLIQHINTFDEL--------VGEQVSVDVKIEEKTKDMILL 59

  Fly   299 CRYN----TITTPFLKLAPFR-------MEELSLDPYVIFYHNVL--------SDAEIEKLKPMG 344
            |..:    |:|...:|:|...       :|.::.:|....|||.|        ::.|.:.|..:.
plant    60 CSLSPLLTTLTCSMVKVAASLRFPNERWLEVITKEPRAFVYHNFLALFFKICKTNEECDHLISLA 124

  Fly   345 KPFLERAKVFRVEKGSDEIDPSRSADGAWL--PHQNIDPDDLEVLNRIGRRIEDMTGLNTRSGSK 407
            ||.:.|:||.....|..|...||::.|.::  .|.       :::..|.:||.:.|.:...:|..
plant   125 KPSMARSKVRNALTGLGEESSSRTSSGTFIRSGHD-------KIVKEIEKRISEFTFIPQENGET 182

  Fly   408 MQFLKYGFGGHFVPHYDYFNSKTFSLETVGDRIATVLFYLNNVDHGGATVFP-------KLNLAV 465
            :|.:.|..|..|.||:|.|           .||||||.||::||.||.||||       |..::|
plant   183 LQVINYEVGQKFEPHFDGF-----------QRIATVLMYLSDVDKGGETVFPEAKGIKSKKGVSV 236

  Fly   466 PTQKGSA-LFWHNIDRKSYDYDTRTFHG 492
            ..:||.| |||..  |.....|..:.||
plant   237 RPKKGDALLFWSM--RPDGSRDPSSKHG 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31016NP_001263119.1 P4Ha_N 31..160 CDD:285528
P4Hc 333..508 CDD:214780 54/170 (32%)
AT4G35820NP_195307.1 UBN2_2 3..77 CDD:290927 16/81 (20%)
P4Hc 115..262 CDD:214780 52/166 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1106
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.920

Return to query results.
Submit another query.