DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31016 and AT3G28490

DIOPT Version :9

Sequence 1:NP_001263119.1 Gene:CG31016 / 326113 FlyBaseID:FBgn0051016 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_189490.2 Gene:AT3G28490 / 822479 AraportID:AT3G28490 Length:288 Species:Arabidopsis thaliana


Alignment Length:228 Identity:75/228 - (32%)
Similarity:109/228 - (47%) Gaps:26/228 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 YNTITTPFLKLAPFRMEELSLDPYVIFYHNVLSDAEIEKLKPMGKPFLERAKVFR-VEKGSDEID 364
            ::.|::....:.|.|:.:||..|....|...|||.|.:.|..:.|..||::.|.. |:.|..|..
plant    17 FSQISSFSFSVDPTRITQLSWTPRAFLYKGFLSDEECDHLIKLAKGKLEKSMVVADVDSGESEDS 81

  Fly   365 PSRSADGAWLPHQNIDPDDLEVLNRIGRRIEDMTGLNTRSGSKMQFLKYGFGGHFVPHYDYFNSK 429
            ..|::.|.:|..:..|     ::..:..::...|.|...:|..:|.|.|..|..:.||:|||..|
plant    82 EVRTSSGMFLTKRQDD-----IVANVEAKLAAWTFLPEENGEALQILHYENGQKYDPHFDYFYDK 141

  Fly   430 TFSLETVGDRIATVLFYLNNVDHGGATVFP------------------KLNLAVPTQKGSALFWH 476
            . :||..|.||||||.||:||..||.||||                  |...||..:||.||.:.
plant   142 K-ALELGGHRIATVLMYLSNVTKGGETVFPNWKGKTPQLKDDSWSKCAKQGYAVKPRKGDALLFF 205

  Fly   477 NIDRKSYDYDTRTFHGACPLISGTKLVMTRWIY 509
            |:.... ..|..:.||:||:|.|.|...||||:
plant   206 NLHLNG-TTDPNSLHGSCPVIEGEKWSATRWIH 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31016NP_001263119.1 P4Ha_N 31..160 CDD:285528
P4Hc 333..508 CDD:214780 65/193 (34%)
AT3G28490NP_189490.2 PLN00052 28..288 CDD:177683 74/217 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.920

Return to query results.
Submit another query.