DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31016 and AT-P4H-1

DIOPT Version :9

Sequence 1:NP_001263119.1 Gene:CG31016 / 326113 FlyBaseID:FBgn0051016 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_181836.1 Gene:AT-P4H-1 / 818910 AraportID:AT2G43080 Length:283 Species:Arabidopsis thaliana


Alignment Length:215 Identity:66/215 - (30%)
Similarity:107/215 - (49%) Gaps:22/215 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 LKLAPFRMEELSLDPYVIFYHNVLSDAEIEKLKPMGKPFLERAKVFRVEKGSDEIDPSRSADGAW 373
            |::...:.|.:|..|.:|..|:.||..|.|.||.:.:|.|:.:.|..|:.|.......|::.|.:
plant    70 LRIGNVKPEVVSWSPRIIVLHDFLSPEECEYLKAIARPRLQVSTVVDVKTGKGVKSDVRTSSGMF 134

  Fly   374 LPHQNIDPDDLEVLNRIGRRIEDMTGLNTRSGSKMQFLKYGFGGHFVPHYDYFNSKTFSLETVGD 438
            |.|..   ....::..|.:||...:.:...:|..:|.|:|.....:.||:||| :.||:|:..|.
plant   135 LTHVE---RSYPIIQAIEKRIAVFSQVPAENGELIQVLRYEPQQFYKPHHDYF-ADTFNLKRGGQ 195

  Fly   439 RIATVLFYLNNVDHGGATVFP-----------KLNLAV---PTQKGSALFWH-NIDRKSYDYDTR 488
            |:||:|.||.:...||.|.||           |:...:   ||:..:.|||. .:|.:|   |.|
plant   196 RVATMLMYLTDDVEGGETYFPLAGDGDCTCGGKIMKGISVKPTKGDAVLFWSMGLDGQS---DPR 257

  Fly   489 TFHGACPLISGTKLVMTRWI 508
            :.||.|.::||.|...|:|:
plant   258 SIHGGCEVLSGEKWSATKWM 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31016NP_001263119.1 P4Ha_N 31..160 CDD:285528
P4Hc 333..508 CDD:214780 58/189 (31%)
AT-P4H-1NP_181836.1 PLN00052 80..281 CDD:177683 64/205 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H94894
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.920

Return to query results.
Submit another query.