DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31016 and P4H13

DIOPT Version :9

Sequence 1:NP_001263119.1 Gene:CG31016 / 326113 FlyBaseID:FBgn0051016 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_850038.1 Gene:P4H13 / 816841 AraportID:AT2G23096 Length:274 Species:Arabidopsis thaliana


Alignment Length:257 Identity:70/257 - (27%)
Similarity:112/257 - (43%) Gaps:39/257 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 SFNQLCRSSSRRQMGESKPSRLHCRYNTITTPFLKLAPFRMEELSLDPYVIFYHNVLSDAEIEKL 340
            ||:::  .::||.:.:...|..| ..:....||        ..||.:|.|.:..|..:..:.|.:
plant    39 SFSEI--PTTRRSVNDETDSLDH-GSSVSNIPF--------HGLSWNPRVFYLPNFATKQQCEAV 92

  Fly   341 KPMGKPFLERAKVFRVEKG--SDEIDPSRSADGAWLPHQNIDPDDLEVLNRIGRRIEDMTGLNTR 403
            ..|.||.| :.....:.||  ::.....||.      ||:.|.|:..||..|..:|...|.....
plant    93 IDMAKPKL-KPSTLALRKGETAETTQNYRSL------HQHTDEDESGVLAAIEEKIALATRFPKD 150

  Fly   404 SGSKMQFLKYGFGGHFVPHYDYFNSKTFSLETVGDRIATVLFYLNNVDHGGATVFPKLN------ 462
            .......|:|..|..:..|||.|:|..:. ..:..|:.|.|.:|::|:.||.|:||..|      
plant   151 YYESFNILRYQLGQKYDSHYDAFHSAEYG-PLISQRVVTFLLFLSSVEEGGETMFPFENGRNMNG 214

  Fly   463 ---------LAVPTQKGSALFWHNIDRKSYDYDTRTFHGACPLISGTKLVMTRWIYELDQMF 515
                     |.|..::|.|:|::|:.... ..|..:.||:||:|.|.|.|.|:||  .||.:
plant   215 RYDYEKCVGLKVKPRQGDAIFFYNLFPNG-TIDQTSLHGSCPVIKGEKWVATKWI--RDQTY 273

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG31016NP_001263119.1 P4Ha_N 31..160 CDD:285528
P4Hc 333..508 CDD:214780 53/191 (28%)